KEGG   Xanthobacter autotrophicus: Xaut_2222Help
Entry
Xaut_2222         CDS       T00581                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Xaut_2222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xau02000]
    Xaut_2222
Enzymes [BR:xau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Xaut_2222
Transporters [BR:xau02000]
 Other Transporters
  Pores ion channels [TC:1]
   Xaut_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABS67466
UniProt: A7IHH3
LinkDB All DBs
Position
complement(2482379..2483002)
Genome map
AA seq 207 aa AA seqDB search
MKLYWAPHTRAFRILWLMEEAGAPYEREVVDIRTGAQDDPAFRRINPMGKVPALSDGDAH
LAESGAICAYVAEQVPAAGLAPPVGDPLRARYLYWMFFSAGCMEPAFLQKLKGIELPKVS
AGWGSFDLVMEVVEEALKDGPYLLGEAFSAADIMLAMDLWYAITLLKVVTPTPRVAAYVA
RCTARPAFHRAEAIEAAELAARAAAAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattgggcgccccacacgcgggccttccgcatcctctggctgatggaggag
gctggagcgccctatgagcgggaggtggtggatatccgcaccggcgcgcaggacgatccg
gccttccgccgcatcaatcccatgggcaaggtgccggcgctgagcgatggcgatgcccat
ctcgccgagagcggcgccatctgcgcctatgtggcggagcaggtgccagccgccggcctc
gcgccgcccgtgggcgatccgctgcgggcgcgctacctctactggatgttcttttccgcc
ggctgcatggagccggccttcctgcagaagctgaagggcatcgagctgcccaaggtctcc
gccggatggggcagcttcgaccttgtcatggaggtggtggaagaggcgctgaaggacggt
ccctatctgctgggcgaggcgttttccgccgccgacatcatgctggccatggacctgtgg
tacgccatcaccctgctgaaggtggtcacgcccacgccccgggtggcagcctatgtggcg
cgctgcaccgcccgccccgccttccaccgcgccgaggccatcgaggcggcggaactggcg
gcccgggcggcggcggccggatag

DBGET integrated database retrieval system