KEGG   Xanthobacter autotrophicus: Xaut_2808Help
Entry
Xaut_2808         CDS       T00581                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00564  Glycerophospholipid metabolism
xau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Xaut_2808
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Xaut_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored 3HCDH_N Pyr_redox_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABS68048
UniProt: A7IJ55
LinkDB All DBs
Position
3128226..3129755
Genome map
AA seq 509 aa AA seqDB search
MMRRRGEAGMEETTRVFDLAIIGGGINGAGIARDAAGRGLSVVLFEQADLASGTSSASTK
LIHGGLRYLEHYAFRLVREALAEREVLWGIAPHIIWPLRFVLPHHAGLRPAWMLRLGLFL
YDHLGGRRLLPPTRTLDLRHDPAGLPLRPGLGTAFEYSDCWVEDARLVVLNARDAADRGA
SIRPRTKVVGAHRVDGLWEIEAEGMAGRESVRARALVDAAGPWAGQVLDVLQVKASARLR
LVKGSHIVVHRLFAHDRCYLFQNGDGRIVFAIPYEGDFTLIGTTDLDYEGRPEDVAASPE
EVAYLCAAASEYFAAALAPEQVVWAYSGVRALYDDGAGKAQEATRDYVLALDAPDGEAPL
LSVFGGKITTYRRLAEATLARLAPHLPVLGPSFTGKVPLPGGDFPRQGFDHLLKSLRRTF
PALDPALLKRLARAYGTSTFRLLEGVMHEDDLGDWFGAHLCRREVDWLMDQEWAMTAEDV
LWRRSKLGLRTRHEEARTLDAYMAARRGG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgccggggggaggcggggatggaggaaaccacgcgcgtcttcgacctcgcc
atcatcggcggcggtatcaacggcgccggcatcgctcgcgatgcggccgggcgcggcctt
tccgtcgtgctgttcgagcaggcggacctggcctccggcacctcgtccgcctccaccaag
ctcatccatggcgggctgcgctacctggaacattacgccttccgcctggtgcgggaggcg
ttggccgaacgtgaggtgctgtggggcatcgctccgcacatcatctggccgctgcgcttc
gtgctgccccaccatgccggcctgcgcccggcgtggatgctgcggctgggcctgtttctc
tacgaccatctgggcggccgccgcctgctgccgcctacgcgcacgttggacctgaggcac
gaccccgccggtctcccgctgcgccccggccttggcacggcgttcgaatattccgactgc
tgggtggaggatgcccgcctcgtggtgctcaatgcccgcgatgcggcggaccggggcgcc
tccatccgtccgcgcaccaaagtggtgggcgcgcatcgcgtcgatggcctgtgggagatc
gaggcggaaggcatggcggggcgcgagagcgtgcgcgcccgcgcgctggtggatgccgcc
ggcccctgggccgggcaggtgctggatgtgttgcaggtgaaggcgagcgcgcgcctgcgc
ctcgtcaagggcagccacatcgtggtgcaccgcctgttcgcgcacgatcgctgctacctg
ttccagaatggtgacgggcgcatcgtgttcgccattccctatgagggcgacttcaccctc
atcggcaccaccgacctcgactatgagggccggccggaggatgtggcggcgagccccgag
gaggtggcctacctctgcgcggcggccagcgagtatttcgccgccgcgctcgcgccggag
caggtggtgtgggcctattccggcgtgcgcgccctgtacgacgacggcgcgggcaaggcg
caggaagcaacccgcgactatgtgctcgccctcgacgcgcccgacggcgaggcgccgctg
ctgtcggtcttcggcggcaagatcaccacctatcgccgccttgccgaggccacgctggcg
cggcttgcgccccatctgccggtgctggggccgtccttcacgggcaaggtgccgctgccg
ggcggggatttcccgcggcagggtttcgatcacctcctgaaaagcctgcgccgtaccttt
cccgccctcgatccggccctgctcaagcgcctcgcacgggcctatggcacatcgaccttc
cgcctgctggaaggggtgatgcacgaggacgacctcggcgactggttcggcgcccacctg
tgccgccgcgaggtcgactggctgatggaccaggaatgggccatgaccgccgaggacgtg
ctgtggcgtcgctcgaagctcggcctgcgcacccgtcatgaggaagcgcggacgctcgac
gcctacatggccgcccggcgcggcggctga

DBGET integrated database retrieval system