KEGG   Xanthobacter autotrophicus: Xaut_3928Help
Entry
Xaut_3928         CDS       T00581                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00970  Aminoacyl-tRNA biosynthesis
xau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Xaut_3928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xau03029]
    Xaut_3928
Enzymes [BR:xau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Xaut_3928
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Xaut_3928
Mitochondrial biogenesis [BR:xau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Xaut_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABS69152
UniProt: A7IMA9
LinkDB All DBs
Position
4345546..4347036
Genome map
AA seq 496 aa AA seqDB search
MTLHVRPTDTKKLISGATGDWEVVIGLEVHAQVASNAKLFSGASTAFGGPPNDHVSLVDA
AMPGMLPVINQECVAQAVRTGLGLKAQIHLTSVFDRKNYFYPDLPQGYQISQYKQPVVGE
GEVIVDLPDGESIPVGIERLHLEQDAGKSIHDLSPTQSFVDLNRSGVALMEIVSRPDLRS
AEEAKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFI
GQAIETEARRQIEILEDGGSISQETRLFDPTRGETRSMRSKEEAHDYRYFPDPDLLPLVL
KPEWVEELKSGLPELPDEKKARFIADYGLSPYDAGVLVAERETAAYFEQVADGGGVKRDG
KAAANFVINELFGRLNKEGKDVTSSPVTPHQIGAILDLIAEGTISSKIAKDLFEIIFTEG
GDPRVVVEARGLKQVTDLGAIEKVVDEIIAKNPDKVAQVLAKPTMLGWFVGQAMKASGGK
ANPQALNDILKAKLGI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacatgttcgccctaccgatacgaagaagctcatttccggtgccaccggcgat
tgggaagtggtgatcggcctggaggtgcatgcccaggtggcctccaacgccaagctgttc
tccggcgcctccaccgctttcggcggcccgcccaatgaccatgtgtcgctggtggatgcg
gccatgcccggcatgctgcccgtcatcaaccaggaatgcgtggcccaggcagtgcgcacc
ggcctcggcctgaaggcgcagatccacctgacttcggtgttcgaccggaagaactacttc
tacccggacctgccgcagggctaccaaatcagccagtacaagcagccggtggtgggcgag
ggcgaggtcatcgtggacctgcccgacggggagagcatccccgtcggcatcgagcgcctg
cacctggagcaggacgccggcaagtccatccacgacctgtcgcccacccagtccttcgtg
gacctcaaccgctccggcgtggcgctgatggagatcgtctcccgccccgacctgcgctcg
gcggaggaggcgaaggcctatgtgacgaagctgcgcaccatcctgaggtatcttggcacc
tgcgacggcgacatggagaagggcaacctgcgggcggacgtgaacgtctccgtgcgccgc
cccggcgaacccttcggcacccgctgcgagatcaaaaacgtcaattccatccgcttcatc
ggccaggccatcgagaccgaggcgcggcggcagatcgagatcctggaggatggcggctcc
atctcccaggagacgcgcctgttcgaccccaccaggggcgaaacgcgctccatgcgctcg
aaggaagaggcgcacgactaccgttacttccccgatccggacctgctgccgctggtgctg
aagcccgagtgggtggaggagctgaagtccggcctgcccgagctgccggacgagaagaag
gcccgcttcatcgccgattacggcttgagcccctatgacgccggcgtgctggtggccgag
cgcgaaacggcggcctatttcgagcaggtggcggacggcggcggcgtcaagcgcgacggc
aaggcggccgcgaacttcgtcatcaacgaactgttcggccgcctgaacaaggagggcaag
gatgtcacctcctcgcccgtgacgccgcaccagatcggcgccatcctcgacctgatcgcg
gagggcaccatctcctccaagatcgccaaggacctgttcgagatcatcttcaccgagggc
ggcgacccgcgcgtggtggtggaagcccgcggcctgaagcaggtgaccgacctcggcgcc
atcgagaaggtggtggacgagatcatcgccaagaacccggacaaggtggcgcaggtgctg
gccaagcccaccatgctgggctggttcgtgggccaggccatgaaggcctccggcggcaag
gccaacccgcaggccctcaacgacatcctgaaggccaagctcgggatctga

DBGET integrated database retrieval system