KEGG   Xanthobacter autotrophicus: Xaut_4221Help
Entry
Xaut_4221         CDS       T00581                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Xaut_4221
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Xaut_4221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Glutaredoxin FAD_binding_3 Thi4 NAD_binding_7 K_oxygenase FMO-like NAD_binding_8 Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABS69442
UniProt: A7IN49
LinkDB All DBs
Position
4674219..4675808
Genome map
AA seq 529 aa AA seqDB search
MLDTAMKTQLKAYLERLVRPVEITAFVDDGAKSKEMLELLSDITDCSPKVTVAERRDGDA
AGARVPSFALSSPGESIALTFAGLPMGHEFTSLVLALLQTGGYPPKLEAEVIEQIKALDG
DFVFETYFSQSCQNCPDVVQALNLMAVLNPKIRHVAIDGALFQKEVDARQVMSVPTVYLN
GEVFGQGRMGVEEIVAKLDTGAAARDAKRMAEMNRFDVLVVGGGPAGATAAIYAARKGIR
TGVAAERFGGQVLDTMAIENFISVPYTEGPKLAAALEQHVREYEVEILNLQKAVKLVPGA
DIVEVEFANGASLRSKTVILATGARWRQMNVPGEDTYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLMEFDSALRADDVLQRKLKSLPNVTILTSAKTTEVLGD
GQKVSGLTYENRNTGESVKVELEGIFVQIGLLPNTEWLKGTVELSPRGEIVVDAHGQTSV
PGVFAAGDCTTVPYKQIVIALGEGAKASLSAFDHLIRSSAPKEEAVKAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacagccatgaagactcagctcaaggcgtatctggagcggctcgtccgaccc
gtcgaaatcaccgccttcgtggatgacggcgccaagtcgaaggagatgctggagctgctc
tccgacatcaccgactgctcgcccaaggtcaccgtcgccgagcgccgcgacggcgatgct
gccggcgcccgcgtgccctccttcgccctgtccagccccggcgagagcatcgcgctcacc
ttcgcgggcctgcccatgggccatgaatttacttcgctggtgctggcgctgctgcagacc
ggcggctacccgcccaagctggaagcggaggtcatcgagcagatcaaggcgctggacggc
gacttcgtcttcgagacctatttttcccagtcctgccagaactgcccggatgtggtgcag
gccctcaacctcatggccgtgctgaacccgaagatccgccacgtggccatcgacggcgcc
ctgttccagaaggaagtggacgcccggcaggtcatgtcggtgcccaccgtgtacctgaac
ggcgaagtgttcggccagggccgcatgggcgtggaagagatcgtcgccaagctcgacacc
ggtgcagccgcccgcgatgccaagcgcatggccgagatgaaccgcttcgacgtgctggtg
gtgggcggtggcccggccggcgccacggcggcgatctatgcggcacgcaagggcatccgc
accggcgtcgccgccgagcgtttcggcggccaggtgctggacaccatggccatcgagaac
ttcatctccgtgccctacaccgagggccccaagctcgccgccgcgctggagcagcatgtg
cgcgagtatgaggtggagatcctcaacctgcagaaggcggtgaagctggtgcccggcgcc
gacatcgtcgaggtggaattcgccaacggcgcgagcctgcgctccaagacggtgattctc
gccaccggcgcccgctggcggcagatgaacgtgccgggcgaggacacctatcgcaacaag
ggcgtggcctattgcccccattgcgacggcccgctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaattccggcgtggaagcggccatcgatctggccggcatcgttgcccac
gtgacgctgatggagttcgacagcgccttgcgcgccgacgacgtgctccagcgcaagctg
aagagcctgcccaacgtcaccatcctcacctcggccaagaccaccgaagtgctgggcgac
ggccagaaggtgagcggcctcacctacgagaaccgcaacaccggcgagagcgtgaaggtg
gagctggaaggcattttcgtgcagatcggccttctgcccaacaccgagtggctgaagggc
actgtggagctgtctccccgcggcgagatcgtggtggatgcccacggccagacctcggtg
cccggcgtcttcgccgccggcgactgcaccacggtgccctacaagcagatcgtgatcgcg
ctgggcgaaggcgccaaggcctcgctctccgccttcgatcacctcatccgctccagcgcg
ccgaaggaagaggcggtgaaggccgcgtga

DBGET integrated database retrieval system