KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0195Help
Entry
XACM_0195         CDS       T01616                                 

Gene name
sodC2
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Brite
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XACM_0195 (sodC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: AEO40505
LinkDB All DBs
Position
228307..228954
Genome map
AA seq 215 aa AA seqDB search
MRIVPTTLFLATALVLTACKREEPAPAEPAPAPQASTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSDHGNVSTEPHHGGDMPNITADAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAATK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgttccgaccaccttgtttctggccaccgccctggtgctgaccgcgtgcaag
cgcgaggaaccagcgccggccgagccggcacccgcaccgcaggccagcacgccggccgaa
gcggcgcacggtggcgaacacgccgcctccatggtcaccgaggcggcggccaccaccacc
gcaaccgccgagctcaagccgaccaagggcaatgacgtcaaaggcacggtgacgttcaag
accgtcgacggtgcgctgcgcgtcaccggccagctcagcggcctcaagcccaataccgag
cacggcttccacatccacgaaaagggcgattgcagcgcaccggacggcagcagcgccggc
ggtcacttcaacccgtcccagtccgatcacggcaacgtcagcaccgagccgcaccatggt
ggcgacatgcccaacatcaccgccgacgcgcagggtaacgccagcatcgacggcccggtc
tccagcaacgtcaacctcggcaaggccgaccagttcgatatcgccggccacgcggtgatc
gtgcatgccgacgcagacgactacaaaacccagcccaccggcaacgcgggcggccgcctg
gcttgcggcgtgatcaccaccgacaacgcgcaggcggcgaccaagtaa

DBGET integrated database retrieval system