KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0863Help
Entry
XACM_0863         CDS       T01616                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00010  Glycolysis / Gluconeogenesis
xax00053  Ascorbate and aldarate metabolism
xax00071  Fatty acid degradation
xax00280  Valine, leucine and isoleucine degradation
xax00310  Lysine degradation
xax00330  Arginine and proline metabolism
xax00340  Histidine metabolism
xax00380  Tryptophan metabolism
xax00410  beta-Alanine metabolism
xax00561  Glycerolipid metabolism
xax00620  Pyruvate metabolism
xax00625  Chloroalkane and chloroalkene degradation
xax00903  Limonene and pinene degradation
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_0863
   00053 Ascorbate and aldarate metabolism
    XACM_0863
   00620 Pyruvate metabolism
    XACM_0863
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XACM_0863
   00561 Glycerolipid metabolism
    XACM_0863
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XACM_0863
   00310 Lysine degradation
    XACM_0863
   00330 Arginine and proline metabolism
    XACM_0863
   00340 Histidine metabolism
    XACM_0863
   00380 Tryptophan metabolism
    XACM_0863
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XACM_0863
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XACM_0863
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XACM_0863
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XACM_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEO41166
LinkDB All DBs
Position
complement(987749..989215)
Genome map
AA seq 488 aa AA seqDB search
MEALFETLRGIAARGPLGLFIDGQWRASTGDRSVDVIAPHTEERLLRYTEPSHADTEAAI
AAARRAFDHGPWPQLSPQARSVALKRVADHLRARMPELAEAWTGQVGATLGFSKRASQQA
PDLFDYYADLIATHAFVEPRVRPNGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKVSFTG
STQAGRSIGIACAERLARVGLELGGKSAAIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRREEVLQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVQSYIAKGKAQGAR
LAMGGGRPAHLSRGFFVEPTVFAEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKVNASD
YGLHGTIYSEDAERAYRIARRVRCGSHAINGMWVDIMPFGGFKHSGIGREGGIEGLHAFL
ETKTLYLS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttattcgaaacgctgcgcggcatcgccgcgcgaggtcccctgggtctgttc
atcgacgggcaatggcgcgcaagcaccggcgatcgctcggtcgatgtgatcgcgccgcat
accgaagaacggctgctgcgctacaccgaaccctcgcacgcagataccgaagcggccatc
gcagctgcacgccgcgccttcgaccacggcccctggccgcagctctccccgcaagcgcgc
agcgtggcactcaagcgggtggccgaccacttgcgtgcacgcatgccggagttggccgaa
gcatggacgggccaggtcggcgcgacccttggcttcagcaagcgcgcctcgcagcaggcg
ccggatttattcgactactacgccgacctgattgccacccacgcattcgtcgaaccacgt
gtgcgccccaacggtggccgcgtgcatgtggtgcaggagccggtcggcgtggtcgccgcg
atcacgccctggaacgcgccgctggtattgctgtgctacaaggtcgccgccgcgctggct
gccggctgcacggtggtggccaagccctcgccggaaacgccgatcgatgcctatatcctg
gccgagtgcatcagcgccgccggcgtgcccgatggcgtgttcaacctgctccccgccggc
cgcgaggtgggcgagcaattgatccgccacccgcacgtggacaaggtcagcttcaccggc
tccacccaggccggccgctcgatcggcatcgcctgcgccgagcgcctggcacgggttggg
ctggagctgggcggcaaatcggcagcaatcgtgctggaggacgccgacatcgccaaggtg
ctgcccaccctggtgccctactccatgccgatcgccggacaggtgtgcttctcgttgacg
cgcgtcctggtgccggcgcagcgccgcgaagaagtcctgcaggcatattgcgcggcactg
agcgcagtgaagctgggcgacccgtttgcggcagacaccgggatgggcccgttggccctg
ggccgccagctcgaacgtgtgcagtcctacatcgccaaaggcaaggcgcagggcgcacgc
ctggccatggggggaggccgcccggcacacctgtcgcgcggcttcttcgtcgaaccgacg
gtgtttgccgaggtgacgccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtgagcttcatcgactaccacgacgaagccgacctcatcgccaaggtcaatgccagcgac
tacggcctgcacggcaccatctacagcgaagacgccgaacgcgcctatcgcatcgcgcgc
cgcgtgcgctgcggcagtcatgcgatcaacggcatgtgggtcgatatcatgccgtttggt
ggcttcaagcactcgggtatcggccgcgaaggcggtatcgaaggtctgcatgccttcctc
gaaaccaaaaccctctacctgagctag

DBGET integrated database retrieval system