KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1573Help
Entry
XACM_1573         CDS       T01616                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00380  Tryptophan metabolism
xax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XACM_1573
Enzymes [BR:xax01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     XACM_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEO41854
LinkDB All DBs
Position
complement(1769568..1770839)
Genome map
AA seq 423 aa AA seqDB search
MTDLLSRAHAAALDAADPLRGLRDAFVFPQHGDDDQTYFVGNSLGLQPRAARAMVDEVLD
RWGALAVEGHFTGPTQWLTYHQLVRDGLARVVGAQPGEVVAMNTLSVNLHLMMASFYRPT
AERGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVDADEPNGTVSMTAIAEAIAQHG
PRLALVLWPGIQYRTGQAFDLAEIVRLARAQGAAVGFDLAHAVGNLPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHARHANSDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLALFDQAGMAALRAKSEQLTGHLEQLIHARVPQVLQIVTPAEPARRG
CQLSLRVAGGRAKGRALFEHLHAAGVLGDWREPDVIRIAPVPLYNRFSDLHTFVEQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgctgtcccgcgcccatgctgctgccctggatgccgccgacccgctgcgc
ggcctgcgcgatgccttcgtgttcccgcagcacggcgatgacgatcagacctatttcgtc
ggcaattcgctcggcctgcagccgcgtgcggcacgtgcgatggtggacgaggtgctcgac
cggtggggcgcgctggcggtggaaggtcacttcaccggcccgacccaatggctgacctac
caccaactggtgcgcgacgggctggcgcgcgtggtcggtgcgcaacccggcgaagtggtg
gcgatgaataccctgagcgtcaatctgcatctgatgatggccagcttctaccgtcccact
gccgagcgcggcgcgatcctgatcgaggccggcgcatttccatccgaccgccacgcggtg
gaatcgcagctgcgcctgcacgggttggacccggccacgcatctgatcgaagtggacgcc
gacgaacccaacggcaccgtctcgatgacggccattgccgaagccatcgcgcagcatggc
ccgcgcctggccttggtgctgtggccgggcatccagtaccgcaccgggcaggccttcgac
ctggccgagatcgtgcggctggcgcgcgcgcagggcgcggcggtgggtttcgatctggcg
cacgcggtgggcaatctcccgctgaccctgcacgacgacggcgtggatttcgcggtgtgg
tgccactacaaatatctcaacgccggccccggcgcggtgggcggttgcttcgtgcacgcg
cggcatgcaaatagcgacctgccgcgcatggccggctggtggggacatgagcagcagacc
cgcttccgcatggacccgcagttcgtgccctcgcccggtgccgaaggctggcagctgagc
aatccgccggtgctggcgctggcaccgctgcgcgcctcgctggcgttgttcgaccaggcc
ggcatggctgcgttgcgcgccaaatccgaacagctcaccgggcatctggagcaattgatc
cacgcgcgggtgccgcaggtactacagatcgtcaccccggcagaacctgcacgacgcggt
tgccagctgtcgctgcgggtggccggcggacgcgcaaagggccgcgcgctgttcgagcat
ctgcacgcggccggcgtgctcggcgactggcgcgaaccggacgtgatccgtattgccccg
gtgccgctgtacaaccgcttcagcgatctgcataccttcgtcgagcaggtggaagcctgg
gcggctgcttga

DBGET integrated database retrieval system