KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2184Help
Entry
XACM_2184         CDS       T01616                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00020  Citrate cycle (TCA cycle)
xax00190  Oxidative phosphorylation
xax00650  Butanoate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xax_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XACM_2184 (sdhA)
   00650 Butanoate metabolism
    XACM_2184 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XACM_2184 (sdhA)
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XACM_2184 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     XACM_2184 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: AEO42451
LinkDB All DBs
Position
2497095..2498885
Genome map
AA seq 596 aa AA seqDB search
MSAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAAL
GNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQR
PFGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGV
CRGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVE
IREGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNM
GGIPTNFYGEVVRKQGDDADAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAVIRDNMQRTMQSDAAVFRTS
KTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESR
GAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYTLSKDVDVVPPKPRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttacaagatcacagaacacaagtacgacatggtcgtggtaggcgccggtggc
gccggcctgcgcgccacgttcggcctggcccagaagggcctgcagacggtctgcctgacc
aaggtcttcccgacccgttcgcacaccgtggcagcgcagggcggtatttccgcggcgctg
ggcaacatgggcgaagacgactggcgttatcacttttacgacaccatcaagggctccgat
tggctgggtgaccaggacgcgatcgagtacatgtgtcgtgaagcgattccggccatcatc
gagctcgaacactacggcgtgccgttctcgcgtaccgaagagggcaagatctaccagcgc
ccgttcggcggcatgaccaccaagtatggcgaaggcccgtcagcgcagcgtacctgcgcc
gcagccgaccggaccggccacgccatgctgcatacgctgtatcagcagtcgctggcgcac
aacgcacgcttcatgatcgagtacttcgcgctcgatctgatcttcgacgaagaaggcgtc
tgccgtggcgtgctcgcactggacatggccgaaggctcgctgcatctgttccgcgcccac
ggtgtggtgctggcgaccggcggttacggccgtgcctacttcagcgccacctccgcacac
acctgtaccggtgacggcggcggcctggtgatgcgtgccggcctgcccgtgcaggacatg
gaattcgtgcagttccaccccaccggcatctacggcgcgggctgcctgatcaccgagggc
gtgcgcggcgaaggcggcatcctgcgcaacagcaatggcgagcgcttcatggagcgctac
gcaccgcattacaaggatctggcgtcgcgcgacgtggtgtcgcgttcgatgacggtggaa
attcgagaaggccgtggcgtgggcgagcacaaggatcacatcctgctcgacctgacccac
cttggtccggaagtgatcaacgaaaagctgcccggcatcgccgaaagcgcacacatcttc
gccggcgtggacgtgaccaagcagccgatcccggtgctgccgaccgtgcactacaacatg
ggcggcattcccaccaacttctacggcgaggtcgtgcgcaagcagggcgacgatgcggat
gcagtggtgccgggcctgtatgccatcggcgaggcggcgtgcgtctcggtccatggtgca
aaccgtctgggttcgaactcgctgctggacctggtggtgttcggccgcgcggttgccaat
cgctgtgccgagacggtcaagcccaatcagccgcacaagacgctgccgtccgatgcctgc
gacaaggccttgggcctgctggacaagctgcgtcacgccaacggctccacgccgacggcc
gtgatccgcgacaacatgcagcgcaccatgcagtcggacgccgccgtgttccgcaccagc
aagacgctgaaagagggcgtggacaagatggccgagatcttcgccaccttcgaagacgtc
aaggtgtctgaccgttcgctggtgtggaattcggacctgatcgagacctatgaattgaac
aacctgctgctcaacgcggtggcgacgatcaattcggccgaacagcgcaaggaaagccgc
ggcgcgcattcgcacgaagacttcccggaccgcgacgacgtcaactggcaaaagcacacg
ctggtgaccgtcgacgacaagggcaagtgcgaattcgattaccgccctgtgcacatgtac
acgctgagcaaggacgtggacgtggtcccgccgaagccgcgcgtttactga

DBGET integrated database retrieval system