KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2186Help
Entry
XACM_2186         CDS       T01616                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00020  Citrate cycle (TCA cycle)
xax00190  Oxidative phosphorylation
xax00650  Butanoate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xax_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XACM_2186 (sdhB)
   00650 Butanoate metabolism
    XACM_2186 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XACM_2186 (sdhB)
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XACM_2186 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     XACM_2186 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AEO42453
LinkDB All DBs
Position
2499115..2499897
Genome map
AA seq 260 aa AA seqDB search
MAEFTLPKNSKIGKGKHYPAKGAKNTRTFKVYRWDPDVDANPRTDSYEIDLDKCGPMVLD
ALIKIKNEIDPTLAFRRSCREGICGSCAMNIDGTNTLACTKAIAACGKSEVPIYPLPHMS
VIKDLVPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPEDRRKLDGLYECILCACCSTS
CPSYWWNGERYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCPK
GLNPALAIAEIKKLMMARRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttcaccctccccaagaattcaaagatcggcaagggcaagcattaccctgca
aagggcgccaagaacacgcgcaccttcaaggtctaccgctgggatccggacgtcgacgcc
aacccgcgtaccgacagttacgagatcgatctggataaatgcggtccgatggtgttggac
gcgctgatcaagatcaagaacgagatcgacccgacgctggcgttccgtcgctcctgccgc
gagggcatttgtggctcgtgcgcgatgaacatcgatggcaccaacacgctggcctgcacc
aaggcgattgccgcatgcggcaagtccgaggtgccgatctatccgctgccgcacatgagc
gtgatcaaggacctggtgccggatctgacgcatttctacgcgcagtacgcgtcgatcaag
ccgtggatccgtacccagaccccgccgccgccggaccgcgagcgcctgcagtcgccggaa
gaccgtcgcaagctcgacggattgtacgaatgcattctgtgcgcatgctgctcgaccagt
tgcccaagctactggtggaatggcgagcggtatctgggcccggcgatcctgctgcaggcc
taccgttggatcatcgattcgcgcgacgaagacaccggtgcgcgtctggacgatctggaa
gacccgttcaagctgtatcgctgccacaccatcatgaactgcgcacggacctgcccgaag
ggcttgaacccggcgctggcgatcgccgaaatcaagaagctgatgatggcgcgtcgcgcc
tga

DBGET integrated database retrieval system