KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3392Help
Entry
XACM_3392         CDS       T01616                                 

Gene name
aspC
Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00220  Arginine biosynthesis
xax00250  Alanine, aspartate and glutamate metabolism
xax00290  Valine, leucine and isoleucine biosynthesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01130  Biosynthesis of antibiotics
xax01210  2-Oxocarboxylic acid metabolism
xax01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XACM_3392 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    XACM_3392 (aspC)
   00220 Arginine biosynthesis
    XACM_3392 (aspC)
Enzymes [BR:xax01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XACM_3392 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     XACM_3392 (aspC)
Amino acid related enzymes [BR:xax01007]
 Aminotransferase (transaminase)
  Class I
   XACM_3392 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEO43639
UniProt: G2LTE4
LinkDB All DBs
Position
3943049..3944320
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIAKAYSRRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLQLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gagatccggggcgagctggcgcgacgagcgcgggagttggaggcgcagggacgcaagctg
atcaagctcaatatcggcaacccgggtgcattcgggttccgcgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccctacacccatcagcagggcctgccg
gaagcgcgcgaggcgatcgccaaggcgtattcgcgacgccagcaccccgatgcccatccg
gaccgtatctttgtcggtaacggggtcagcgagctgatcgacctgtcgctgcgcgccctg
ctcaaccccggcgatgaagtgctggtgccctcgcccgactacccgctgtggtcggcggcg
accatcctcaatgacggccgcccggtgtattaccgctgcgcgccggagaatggcttccag
ccggacccggtggagatcgaaacgctggtgtcctcgcgcacccgcgccatcgtgttgatc
aatcccaacaaccccagcggtgcgagctattcgcgcgagttgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctgctgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcaccgctggccggtgcgcacccatgcatcaccttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcgctgctgtcg
ggcgaccaagcgcgcatcaacgacctgcgcaatgcgatggacctgctcggcgcgctgcgc
ctgtgcgccaatgtgccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcgctgtgcgcgccgggcggccgcctgtatgaaacccgccgcgcggtgatcgag
gcctgtgcggccagcgagcatctgcagctggtggcaccggccggggcgctgtatgcgttc
ccggcggtggtgggcgcagcggcgcgcaacttcgacgatcatgcgttcgcactcgatctg
atgaacgaagaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccac
catttccgcgtgaccctgatgccggaagccggtgtgatgcgcgatgtgttcgcccgcatc
gaccgtgcattggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system