KEGG   Ahniella affigens: C7S18_02385Help
Entry
C7S18_02385       CDS       T05483                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
xba  Ahniella affigens
Pathway
xba00620  Pyruvate metabolism
xba01100  Metabolic pathways
xba01120  Microbial metabolism in diverse environments
xba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C7S18_02385
Enzymes [BR:xba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     C7S18_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ThiF
Motif
Other DBs
NCBI-ProteinID: AVP96111
UniProt: A0A2P1PMN9
LinkDB All DBs
Position
655166..657460
Genome map
AA seq 764 aa AA seqDB search
MSLSEELKKQALDYHRQHPPGKIKVTATKSLVTQKDLSLAYSPGVAAACEEIVRDPSTAS
LYTARGNLVAVISNGTAVLGLGPIGALASKPVMEGKGVLFQKFAGIDVFDIEVNERDPDK
LVDIIAALEPTFGGINLEDIKAPECFYIEKKLRERVKIPVFHDDQHGTAIIVGAAVLNAL
HIVGKKIDEVRLACSGAGAAGIACLDMLVALGLKKENILVVDRNGVVYEGRAEDMDADKL
RYARPTAKRTLAEIVDGADIFLGLSAAGVLKPDMVKTMAERPVILALANPTPEILPELAL
EARPDCIIATGRSDYPNQVNNALCFPYIFRGALDVGATTINEAMKLACVHAIAALARREA
SDVAAAAYGGRSVSFGPEYLIPQPFDPRLIVELAPAVAKAAMDTGIATRPMADLAAYKEK
LQQFIFRTGLLMKPIFERARSEPQRVAFAEGEEETVLRAVQTIVDERLARPILIGRPAVI
ERRIQKLGLRLEAGRDFELTNIDDDPRFNRYWQRYHETMQRRGVTPDGAKAIMRSRATVV
ASIMVDTGEADALICGLVGRYHRKLKHVLDVIPLDKGVQSVAAMTAVANDRGTFFFLDTH
VQAEPTAEQLAEATLQATYRLRLFGITPKVALLSHSNFGSHDTASARKMQRVRELVLERA
PRLEIEGEMHADAALNEAIRNRLFPNSRLTGMANLFVCPNLDAANIAYNITRQMTDGVAI
GPILMGISKPAHVLTPASTVRRVVNMTALAAVEAQIRERMGGPV
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtccgaagaactcaagaagcaagccctggactatcaccggcaacacccgcca
ggaaagatcaaagtcaccgcgaccaagtctctggtgacccaaaaggacttgtccctggcg
tactcgccgggtgtggcggccgcttgcgaggagattgtcagagacccgagcacggcgagc
ttgtataccgcccgtggcaatctggtagcggtgatctccaatggcaccgcggtgcttggt
ctcgggcccatcggtgcgctggcgtcgaagccggtgatggaaggcaagggtgtgctgttc
caaaaatttgccggcatcgacgtgttcgacatcgaagtcaatgagcgggacccggacaaa
ctcgtggacataattgccgcgttggagccgacgtttggcgggatcaatctggaagacatc
aaggcgcccgagtgcttctacattgaaaagaagctgcgtgaacgcgtcaagattccagtc
ttccacgacgatcagcatggcacggccatcattgtgggtgcggcggtactgaatgcgctg
catattgtcggcaagaagatcgatgaagtccggttggcctgttcgggcgccggcgcggcc
gggatcgcgtgtctcgacatgctcgtcgctttgggcttgaagaaagagaacatcctcgtg
gtcgatcgcaacggcgtggtctatgaaggccgcgccgaggacatggatgccgacaagctc
cgttatgcgcggccgacggccaagcgcaccctcgctgaaatcgtcgatggcgcagacatt
tttctgggcttgagtgccgccggggtgctgaagccggacatggtcaagaccatggccgag
cgcccggtgattctggcgctcgccaacccgacgcccgagatattgcccgagctggcgttg
gaagcgcgtcctgactgcatcattgcgacgggtcgcagcgactatccgaaccaggtcaac
aatgcgctgtgtttcccgtacatttttcgtggcgcgctggatgtgggcgcgaccaccatc
aacgaggcgatgaagcttgcttgcgtgcatgccattgcagcgctggcgcggcgagaagca
tccgatgtcgcagccgccgcgtacggcgggcggtcagtcagcttcggtccggagtacttg
atcccgcagccctttgatccgcgcctgatcgtcgaattggcgccggcagttgccaaggcg
gcaatggataccggtatcgccacgcgtcccatggccgacctcgcggcgtacaaggaaaaa
ctccagcagttcatcttccggaccgggctcctgatgaagcccattttcgaacgcgcgcgg
agcgaaccgcagcgtgttgcgtttgccgaaggtgaggaggaaaccgtactgcgcgcggtg
cagaccatcgttgacgagcgattggcgcggcccattttgattgggcgccccgccgtgatc
gaacgacggattcagaagctcggtctgcggctggaggcaggccgtgacttcgagctgacc
aatatcgatgacgatccacgcttcaaccgctattggcagcgttaccacgaaacgatgcag
cggcgcggggtcacgcccgacggcgcgaaagccatcatgcgctcccgcgccacggtcgtt
gcgtcgatcatggtcgatacgggcgaggccgatgcgctgatttgcggcctggtcggacgc
tatcaccgcaagctcaagcatgtgctggacgtgattccgctcgacaagggcgtgcagtcg
gtcgccgccatgacggccgtggcgaatgatcgcggcacgttcttcttcctcgatacacat
gtgcaggccgaacccacggccgagcaactggccgaagccacgttgcaggccacgtatcgg
ttacgcctctttggtatcacccccaaagtggcgctgttgtcacattccaacttcgggtcg
cacgacaccgcgagcgcccgcaaaatgcagcgtgtccgcgagctggtgctggagcgcgcg
ccgcgtcttgagatcgaaggcgagatgcacgctgatgccgcgttgaacgaagccattcgg
aatcgcctgttcccgaattcgcgactgaccggcatggccaatctgtttgtgtgcccgaac
ctcgatgccgcgaacatcgcctacaacatcacccgtcagatgaccgacggggtggcgatt
ggtccgattctgatggggatctcgaagcccgcgcacgtgctgacgccggcctccacggtt
cgccgggtcgtcaacatgacggcgcttgcggcggtcgaagcgcagattcgcgagcgcatg
ggcggcccggtctga

DBGET integrated database retrieval system