KEGG   Ahniella affigens: C7S18_16880Help
Entry
C7S18_16880       CDS       T05483                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xba  Ahniella affigens
Brite
KEGG Orthology (KO) [BR:xba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7S18_16880
Enzymes [BR:xba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7S18_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_3 FAD_binding_2 K_oxygenase Thi4 Glutaredoxin AlaDh_PNT_C DAO FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AVP98760
UniProt: A0A2P1PVA6
LinkDB All DBs
Position
complement(4376027..4377604)
Genome map
AA seq 525 aa AA seqDB search
MLEQDLKDALKSYLERLTRPLVLLANVDESAASHELRTLLAEIAEASAMITVQEQHDPSL
RVPSFAVGSPGHDIKLRFAGIPLGHEFTSLVLALLQAGGYPPKVSAETIEAIKQLPGPLR
FESFFSLSCQNCPDVVQALNLMAVLNPNIDHVAIEGGAFQHEVEARQVMSVPSVFLNGEL
FAVGRMSIEEIVAKLDTGAAARDAETLKQKDPFDVLIVGGGPAGAAAAVYAARKGIRTGL
VAERFGGQVMDTMGIENLISVPETEGPKLVAALENHVGHYDVDVMKLQRAEKLSVANDLV
TIQLASGASLSSKTVIIATGARWRQMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVSHVTLIEFDGQLRADAVLQRKLRSLSNVRVIVSAQTTEVKGDGQR
VTGLVYKDRGTNDLRTIDLEGIFVQIGLLPNSDWLKGALELTNRGEIVVDAKGATSLPGV
FAAGDVTTTPYKQIVIAMGEGSKAALSAFDHLIRMAVPEPAKQAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttggaacaagacctgaaagacgcgctgaaaagctatctcgagcgcctgacccggccg
ctggtgcttctcgccaatgtcgatgagagcgccgcgtcccatgaacttcgaaccctgctt
gccgaaatcgcggaagcttcagcgatgatcaccgtgcaagagcagcacgaccccagtctg
cgcgtgccgtcgttcgcggttggcagccctgggcacgacatcaaacttcgcttcgccggt
atcccgctgggccacgagttcacctcgctcgtactggcgctgctgcaggctggcgggtat
ccacccaaggtatcggccgaaacgatcgaagcgatcaagcaactgcctggcccgcttcgt
ttcgagagcttcttctcgctgtcgtgtcagaactgcccggatgtggttcaggcactgaac
ctgatggccgttctgaatccgaatatcgaccatgtcgcgatcgaaggtggggcgttccag
cacgaagtcgaagcgcgccaagtcatgtccgtgccgagcgtgttcctgaatggcgagttg
ttcgcagtcggtcgcatgagcatcgaagaaatcgtcgcgaaactcgacaccggcgctgca
gcgcgcgacgccgagacgctcaagcagaaagaccccttcgacgtgctgatcgtcggcggc
ggcccagcgggcgctgcggcggcggtctatgctgcgcgcaaagggattcgcaccggcttg
gttgccgagcgcttcggcggtcaagtcatggacaccatgggcatcgagaacctgatctcg
gttcccgaaaccgaaggtcccaaactggtcgcggcattggaaaaccatgtcggtcattac
gatgtcgacgtgatgaagctgcagcgcgcggagaaactcagcgtcgccaatgacctcgtc
acgatccagctcgccagcggcgcaagcctgagctcgaagacggtgatcatcgcaaccggc
gcccgctggcggcagatgaacgtgccgggcgaagccgagtaccgcaacaaaggcgtggcc
tattgcccgcactgcgatggtccgctattcaaaggtaagcgcgttgcggtcattggcggc
ggcaactccggcgtggaagcggcgattgatcttgcgggcatcgtcagtcacgtgacgctg
atcgagttcgacggtcagctccgcgcagacgcggtgttgcagcgaaagctccgcagtttg
tccaacgtgcgcgtcatcgtgtcggcgcagaccaccgaagtgaagggcgatggccagcgc
gtgaccggcctcgtctacaaggaccgcggcaccaacgatctgcgcacgatcgatctggaa
ggcatctttgtccaaatcggtctgctgccgaattccgattggctgaagggcgcgttggag
ctcaccaatcgcggcgaaattgtcgtcgacgccaagggcgccacgtcactgcccggcgtg
tttgcggcgggcgatgtgacgacgacgccatacaagcagatcgtcatcgcgatgggcgag
ggttctaaagccgcgttgtcggccttcgatcacctgatccgcatggcggtcccagagcct
gcaaaacaggccgcctga

DBGET integrated database retrieval system