KEGG   Xanthomonadaceae bacterium AQ6-296: ELE36_12240Help
Entry
ELE36_12240       CDS       T06010                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
xbc  Xanthomonadaceae bacterium AQ6-296
Pathway
xbc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xbc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ELE36_12240 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xbc02000]
    ELE36_12240 (pstB)
Enzymes [BR:xbc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ELE36_12240 (pstB)
Transporters [BR:xbc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ELE36_12240 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_30 RsgA_GTPase AAA_22 AAA_23 AAA_29 AAA_25 AAA_33 Rad17 Mg_chelatase AAA NB-ARC AAA_15
Motif
Other DBs
NCBI-ProteinID: QBB71058
UniProt: A0A411HKN6
LinkDB All DBs
Position
complement(2878706..2879533)
Genome map
AA seq 275 aa AA seqDB search
MPNDFSQPLNASVLPVMRTDLLAGKTLALQAQALNLFYGDRQILHALNLSVPARHVTALV
GPSGCGKSTFLRCCNRLNDEVDGCRVSGSVKLAGSDIHGGDLPVPELRRRVGMVFQKPNP
FPLTVYDNVAYGLRLAGLRRRRELDERIESVLKVVGLWDEVATRLHEDALILSSGQQQRL
VIARALAVEPEILLMDEPASMLDPISTLRFEELVHQLAQRYTVLVVTHNMQQAARVADYT
AFMYQGRVLEFGDTDSVFTNPQRRETEDYITGKFR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgatttttcccagccattgaatgccagcgtattgccggtcatgcgcacggat
ttgcttgccggaaaaaccctggcattgcaggcgcaggcattgaatctgttttacggcgat
cgacagattttgcatgcgctgaatttgtccgtgccggcgcggcatgtcaccgcgttggtc
gggccgagcggctgcggaaaatccacgttcctgcgttgctgcaaccggctcaacgacgag
gttgacgggtgtcgtgtcagcggcagcgtgaaacttgccggcagcgatattcacggcggc
gatttgccggtgccggagttgcgccgtagggtcggcatggtgttccagaaaccgaatcca
tttccgctgacggtatacgacaatgttgcgtatggattgcgcctggccggtttgcggcgg
cggcgtgaactcgatgaacgtatcgaatcggtattgaaagtcgtcggactgtgggacgaa
gtggcgacgcgattgcacgaagatgcgctgatactttccagcggccagcagcaacgtctg
gtgattgcgcgcgcactcgcggtggagccggaaattctgctgatggatgaacccgcatcg
atgctcgatccgatttccaccttgcgtttcgaggagctcgtgcatcaactcgcgcagcgc
tacaccgtgctcgtggtgacgcacaatatgcagcaggccgcgcgtgtcgccgactacacc
gcgttcatgtatcagggtcgcgtgctcgagttcggcgataccgacagcgtattcaccaat
ccgcagcgtcgcgagactgaggattacatcaccgggaaatttcgctga

DBGET integrated database retrieval system