KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0083Help
Entry
XBJ1_0083         CDS       T01186                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00250  Alanine, aspartate and glutamate metabolism
xbo00410  beta-Alanine metabolism
xbo00640  Propanoate metabolism
xbo00650  Butanoate metabolism
xbo01100  Metabolic pathways
xbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XBJ1_0083 (goaG)
   00650 Butanoate metabolism
    XBJ1_0083 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XBJ1_0083 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_0083 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xbo01007]
    XBJ1_0083 (goaG)
Enzymes [BR:xbo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XBJ1_0083 (goaG)
Amino acid related enzymes [BR:xbo01007]
 Aminotransferase (transaminase)
  Class III
   XBJ1_0083 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBJ79234
UniProt: D3UY56
LinkDB All DBs
Position
89072..90355
Genome map
AA seq 427 aa AA seqDB search
MTESMLAKRRSAAIAKGVGVTTQVYVERAENAEIWDAQGQRYIDFAAGIAVVNTGHRHPR
VIAAAREQLEQFIHTCHQVVPYENYVALAERLNRLVPGNFVKKTVFVTTGAEAVENAVKI
ARAATGRSGVVAFSGAFHGRTFLGMSLTGKVVPYKMGFGSLVSDVYRVPFPVALHGISVE
QTLNALDNLFKTDIEPTRVAAIIIEPVQGEGGFYPAPPELLKSLREIADRYGIVLIADEI
QTGFARTGKLFAMEHHEVAADLTTMAKGLAGGFPLAAVTGRAELMDAVAPGGLGGTYGGN
PVAIAAGHAVLDVIEEEKLAARATQLGERLKQCLNELRPRVPQIADVRGLGLMIAVEFNR
ADSQEPDAGFTNAVRQKALERGLILLACGIHGNVIRFLPPLTIQNDVFDEALNVLESVLL
DLNRTAV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctatgttagctaaaaggcgcagcgcggctatcgcaaaaggcgtcggcgtg
acgacacaagtctatgttgaacgtgcggaaaatgctgaaatctgggatgctcaggggcaa
cgctatattgattttgccgcaggtatcgctgtggtgaataccggccaccgccacccgcgc
gtcattgccgcagccagagagcagctggaacaatttatccatacctgtcatcaggtcgtg
ccttatgaaaattatgtagcgttagccgaacgactgaaccgtctggtgccgggtaatttc
gtgaagaagaccgtttttgttaccaccggggctgaggcggtagaaaatgctgtgaagatc
gcgcgtgccgcaaccgggcgcagcggcgtagtggctttcagtggcgcttttcatggccgt
actttcctcggtatgtcattaaccggcaaagtcgtgccgtacaaaatggggttcggctcg
ctggttagcgacgtttatcgtgttccgtttccggtagcgctgcacggtatcagcgtggaa
cagacgctgaacgcgctggataatctcttcaaaaccgatattgagccgacgcgtgtcgct
gccatcatcattgagccggtacagggagaaggcggtttctatcctgcgcctcccgaactg
ctcaaatccctgcgcgaaattgctgatcgctacggtattgtccttattgccgatgaaatt
cagaccggtttcgcgcgtaccggcaaactgtttgctatggaacatcatgaggttgcagcc
gatctgaccacgatggcaaaaggtctggcagggggatttccgctggcggctgtaacgggg
cgagcagagctgatggatgcggtagcaccgggtggcttggggggaacctatggaggtaat
ccggtggcgattgcggctggccatgcggtgctggatgtgatcgaagaagagaagctggct
gcgcgtgcgacgcagctgggagagcggctaaaacaatgtctgaatgaactgcggccgcgt
gtcccgcagatcgccgacgtgcgtgggcttgggctgatgattgctgtggaatttaaccgt
gcggacagtcaggaacccgatgccggctttaccaacgccgtgcgtcagaaagcgctggag
cggggtctgattctgttggcgtgcggtatacacggtaacgtgatccgttttcttccaccg
ctgactatacaaaatgatgtttttgacgaggcgctcaacgttctggagtctgtactgctc
gatctgaaccgtaccgccgtttaa

DBGET integrated database retrieval system