KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0492
Entry
XBJ1_0492         CDS       T01186                                 

Gene name
ygdE
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase, SAM-dependent domain
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xbo03009]
    XBJ1_0492 (ygdE)
Enzymes [BR:xbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     XBJ1_0492 (ygdE)
Ribosome biogenesis [BR:xbo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XBJ1_0492 (ygdE)
SSDB
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN MIT_C
Other DBs
NCBI-ProteinID: CBJ79641
UniProt: D3UWD2
LinkDB
Position
complement(493006..494103)
AA seq 365 aa
MNKVALYCRPGFEKECAAEITDKAGKKGIYGFARVKENSGYVLFECYQHDDADRLIREIP
FGELIFARQMVVVGELLKNLPQEDRITPILGMLTGVIERAGELRVEVPDNDESKELMTFC
RKFTVPLRHAMRQEKFLLAKESANRPVIHVLFIAPGCCYVGYSYSNNNSRFYMGIPRLKF
PSDAPSRSTLKLEEAFHVFIPHDEWEERLGSGLYAVDLGACPGGWTYQLVKRGMIVHAVD
NGLMADSLMDTGQVKHHRVDGFKFEPTVKNVYWLVCDMVEQPAKVAHLMTDWLVKSWCRE
AIFNLKLPMKKRYEEVAQILQKIEQQLKENGVNAQIQAKHLYHDREEVTVHVRRIWSAYA
MTRDF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaataaagttgctttatattgccgccccgggtttgaaaaagagtgtgcggcagaaatt
actgataaggcgggtaagaaaggaatttacggttttgcccgcgtaaaagaaaacagcggt
tatgtgttgtttgagtgttatcagcatgatgatgcggatcgtctgatccgtgaaattccg
ttcggtgaattgatctttgcccgccagatggtggttgtgggtgaattgctcaaaaattta
cctcaggaagatcgtattacccctatccttgggatgttgacgggggttattgaacgtgca
ggtgagctgcgcgtagaagtgccggataatgatgaaagtaaagagttgatgacattctgc
cgtaagtttacggttccgctgcgtcatgccatgcgtcaggaaaaattcttgctggcaaag
gaaagtgctaaccgcccggtgattcatgttttgtttattgctccgggctgttgttacgtc
ggctattcttacagcaacaacaattcccgtttttatatggggatcccccgtctgaagttt
ccgtcagatgctccgagccgttcaacgctgaagctggaagaagcttttcatgtattcatt
ccacatgacgagtgggaagaacgtctgggcagtgggctgtatgcagtggatcttggtgct
tgtccgggaggctggacttaccagctcgtgaaacgcgggatgatagttcatgcggtagat
aatggcttgatggctgatagtttgatggacaccgggcaggtgaaacatcatcgtgtggat
ggcttcaaatttgaacccacagtgaaaaatgtttactggctggtttgtgacatggttgag
cagcctgctaaggttgcccatctcatgacagactggctagtgaaaagctggtgtcgtgaa
gccattttcaacctcaagttgccgatgaaaaagcgttatgaggaagttgctcagatcttg
cagaagatagaacagcaactgaaagaaaatggagttaatgcccaaattcaggccaagcac
ttgtaccacgatcgtgaagaggtcacggtacatgttcgtcgtatttggtctgcatatgca
atgacccgggatttttaa

DBGET integrated database retrieval system