KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1497
Entry
XBJ1_1497         CDS       T01186                                 

Definition
(GenBank) putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: CBJ80625
UniProt: D3V073
LinkDB
Position
complement(1463591..1464559)
AA seq 322 aa
MNTSRLAFPVVITLAAACAPVTQAAINTAQIVAGSLSPACIQWQVSGICYWLFCSWHGCT
VKTSVKVTHFLPQAVVSTYHAPGGNPWSEMAHISPLSGGLENAVTGALSGLTTGGGNHTV
QVAGKRSPRLRFKYADAIGHPATTLIGGQIPGYSCRSAATPLMPYFLSTLDTVAWRSGLP
ESLYPEALVPGLRELGSQPVGNMWGNLYPRSGFVTQADEDKAAAVVAQRVADIITRTGQP
HVYQPLAGQRRDGYWPPEPMQENTGTKNHQWQRLSPQLSQSCAVFPDGRHTAAADSNQAY
ALWQPYSCCQRRGQRFLGSTAI
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaatacgtcacgcctggcttttccggtggttatcacgctggccgcggcatgtgcgcct
gtcacacaagccgccattaataccgcccaaatcgtggccggcagtctctcgcccgcctgt
attcagtggcaggtcagtggcatttgttactggctgttttgttcctggcacggctgtacg
gtgaaaacctcggtcaaagtgacccatttcctgccgcaggcggtggtctccacctatcat
gcgcccggcggcaacccgtggtctgaaatggctcacatcagcccgttatccggcggactg
gaaaatgcggtaacgggggcgttatccggcctgaccaccggcggcggtaatcacacggtt
caggttgccgggaagcgcagtccccgtctgcgtttcaaatacgccgatgctatcgggcat
cccgctactacgctgattggcggacaaatcccggggtattcctgtcgcagtgcggccaca
ccgctgatgccctattttctcagcacactggatactgtcgcgtggcgcagcggactgccg
gagtcgctttatcctgaagcgcttgttcccggtctgcgtgaactgggcagccagccggtg
ggcaatatgtggggcaatctctacccccgttccggttttgtcacgcaggctgatgaggat
aaagccgctgccgtggtggcacagcgggtggcggacattatcacccgtaccgggcagccc
catgtttatcagccactggccgggcaacgccgtgacggctactggccaccagagccgatg
caagaaaataccggcacgaaaaatcaccaatggcaacggttgtcaccacagttaagtcag
tcctgtgcagtattcccggatggccgccacacagcggcggcagacagcaatcaggcgtat
gccctgtggcagccctacagctgttgccagcggcgcgggcaacgttttctcggcagtacg
gcaatataa

DBGET integrated database retrieval system