KEGG   Xenorhabdus bovienii SS-2004: XBJ1_4062Help
Entry
XBJ1_4062         CDS       T01186                                 

Gene name
tufA
Definition
(GenBank) protein chain elongation factor EF-Tu (duplicate of tufB)
  KO
K02358  elongation factor Tu
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:xbo03012]
    XBJ1_4062 (tufA)
   03029 Mitochondrial biogenesis [BR:xbo03029]
    XBJ1_4062 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xbo04147]
    XBJ1_4062 (tufA)
Translation factors [BR:xbo03012]
 Eukaryotic Type
  Elongation factors
   XBJ1_4062 (tufA)
 Prokaryotic Type
   XBJ1_4062 (tufA)
Mitochondrial biogenesis [BR:xbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    XBJ1_4062 (tufA)
Exosome [BR:xbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XBJ1_4062 (tufA)
  Exosomal proteins of breast cancer cells
   XBJ1_4062 (tufA)
  Exosomal proteins of colorectal cancer cells
   XBJ1_4062 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C DUF520
Motif
Other DBs
NCBI-ProteinID: CBJ83174
UniProt: D3V695
LinkDB All DBs
Position
complement(3915029..3916213)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVLVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAEWEAKIIELADALDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
DEVSIVGITDTVKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIQRGQVLAKPGSIQ
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VTLIAPIAMDEGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaagtttgaacgtaaaaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcaatcaccactgttctggcgaaaacttac
ggcggtagcgctcgtgcattcgatcagatcgataatgcaccagaagaaaaagcgcgtggt
atcaccatttctacttctcacgtagaatacgataccccaactcgccactatgcgcacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcacgggtgctgctcagatggat
ggcgcagttctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccatacatcatcgtgttcctgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggttgaaatggaagtccgtgagctgctgtctcag
tacgatttcccaggcgatgatacgccaatcatccgtggttctgctctgaaagcgttggaa
ggtgaagcagagtgggaagcgaaaattatcgaactggcagatgcactggattcctacatc
ccagagccagagcgtgacattgacaagccattcctgctgccaatcgaagacgtattctcc
atctctggccgtggtactgtagttactggtcgtgtagagcgtggtatcgttaaagtgggt
gacgaagtttcaatcgttggtatcacagatacagtgaaaacaacttgtactggcgttgaa
atgttccgcaaattgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtactaagcgtgacgaaatccaacgtggtcaggtactggctaaaccaggttcaatccag
ccgcacactcaattcgaatcagaagtttatattctgagcaaagatgaaggtggccgtcat
actccattcttcaaaggttaccgtcctcagttctacttccgtacaactgacgtaaccgga
actatcgaactgccagaaggcgttgagatggtaatgccaggtgacaacatcaacatgatc
gttaccctgattgctccaatcgcaatggacgaaggtctgcgtttcgcaatccgtgaaggt
ggccgtactgtaggtgctggtgttgttgctaaagtgattgcataa

DBGET integrated database retrieval system