KEGG   Xenorhabdus bovienii CS03: XBW1_0315Help
Entry
XBW1_0315         CDS       T03845                                 

Gene name
pstB
Definition
(GenBank) Phosphate import ATP-binding protein pstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
xbv  Xenorhabdus bovienii CS03
Pathway
xbv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XBW1_0315 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xbv02000]
    XBW1_0315 (pstB)
Enzymes [BR:xbv01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     XBW1_0315 (pstB)
Transporters [BR:xbv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    XBW1_0315 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 AAA_22 AAA_29 RsgA_GTPase AAA_16 Rad17 AAA_30 AAA_33 PRK G-alpha ATPase_2 AAA_14 RNA_helicase AAA_28 TniB PhoH AAA_24 AAA_5 AAA_7 Mg_chelatase AAA_25
Motif
Other DBs
NCBI-ProteinID: CDM87674
UniProt: A0A0B6X5Q0
LinkDB All DBs
Position
complement(310129..310905)
Genome map
AA seq 258 aa AA seqDB search
MNKANDIAGSKIQVRDLNFYYGKFHALKNITLDIAQNKVTAFIGPSGCGKSTLLRTFNKM
YELYGEQRAEGEIILDDTNILTDKQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFE
KLPRAEMDERIQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDE
PCSALDPISTGRIEELISELKSEYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSDTDTL
FTTPRKKQTEDYITGRYG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggctaacgacattgcaggaagcaaaattcaggtacgtgatctgaacttctat
tacggcaaatttcacgcgctgaaaaacatcacactggatattgcgcagaataaggtgaca
gcctttatcggcccgtcggggtgcggcaagtccacgttactgcgtactttcaacaaaatg
tatgaactgtatggcgaacagcgggcagaaggcgaaattatactggatgacaccaatatc
ctgacggataaacaagatatcgccctactgcgtgccaaagtcggcatggtgttccaaaaa
ccgacaccattcccgatgtccatttatgacaatatcgcttttggtgtgcgtctgtttgaa
aaactgccaagggctgaaatggatgaacgcatccagtgggcgctgacaaaagccgcattg
tggaatgagaccaaagacaaactgcaccagagtggttatagcctttccggtggtcagcag
cagcgtttatgcattgcccgtggtattgcgatacgtccggaagtcttgttgttggatgaa
ccgtgctcggcacttgacccgatctccaccggacgtattgaagagttaatcagtgaattg
aaatcggaatatactgtggtgatcgtcacccataacatgcagcaggccgcgcgctgttct
gaccacactgcatttatgtacctcggagaattgatcgaattcagtgacacagacacgctg
ttcaccacacccagaaagaaacagactgaagattatattacaggccgttacggttga

DBGET integrated database retrieval system