KEGG   Xenorhabdus bovienii CS03: XBW1_3274
Entry
XBW1_3274         CDS       T03845                                 

Gene name
rlmL
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase L
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
xbv  Xenorhabdus bovienii CS03
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xbv03009]
    XBW1_3274 (rlmL)
Enzymes [BR:xbv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     XBW1_3274 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     XBW1_3274 (rlmL)
Ribosome biogenesis [BR:xbv03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XBW1_3274 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_15 Methyltransf_3 N6_Mtase Methyltransf_24
Other DBs
NCBI-ProteinID: CDM90631
UniProt: A0A0B6XBS7
LinkDB
Position
complement(3093251..3095368)
AA seq 705 aa
MNSLFASTARGLEELLKNELEMLGAQSCKIAQGGVHFQGDDRVMYKSLLWSRLASRILMP
LNEFNVYSDLDLYLGVQSIDWSEIFSVDSTFSVHFSGTNEEIRNTQYGALRVKDAIVDSF
VRKIKQRPDVAKQQPDIRIDVFLNKEKATLSLDLSGEGLHIRGYRDLAGQAPLKETLAAA
VVLRSGWKAGTPLIDPMCGSGTLLIEAAMMAADGAPGLHRQHWGFTSWLKFDQEIWREMM
AEAQVRFRKGLQETTSRFFGSDIDRRVMDMARSNARRAGVAHLIQFQQGDASKLENPLPE
GAVGTILSNPPYGERLESEPALVALHSIFGRIMKSRFPGWRLSLFSASPELLSCLQLRAE
REFKAKNGPLDCVQKNYQLSDKPQSLDAGIADDYANRLRKNEKKLSKWAKQQGIDCYRLY
DADLPEYNVAIDRYADKVVVQEYAPPKTVDANKARQRLFDVISATMNVLELSSNQLILKT
RQRQTGKNQYEKMAEKKEFFLVNEYGAKFWVNLTDYLDTGLFLDHRIARKKLGEMSQGKD
FLNLFAYTGSATVHAGLGGARSTTTVDMSRTYLEWAEKNLQANGLSGRQHRLIQADCLGW
LAQSREQFDLIFIDPPTFSNSKRMEDSFDVQRDHIPLMKQLKCLLRRGGTLMFSNNKRGF
KMDFAELEKLGLVAEEITEKTVSQDFARNRQIHNCWLLRHAGEEK
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgaactctctctttgccagcacggcacgtgggctggaagaattattaaaaaacgaattg
gaaatgctgggagcgcaatcctgcaagattgcccaaggtggggttcattttcaaggtgat
gatcgggtgatgtataaaagcttgctctggagcaggctggcatcacgtatcctgatgccg
cttaacgaattcaatgtttatagcgatttggatctctatcttggggttcaatctattgac
tggagcgaaattttttccgtcgatagcacattctcagtgcatttcagtggcacgaatgag
gaaatcagaaacacacaatatggtgccctgagagtgaaagacgccattgttgatagcttt
gtacgtaaaataaagcaacgtcctgatgttgccaaacaacagccggatattcgcattgat
gtttttctgaacaaagaaaaagcgacactgtcgcttgatttgagtggagaagggttgcat
atccgtggctaccgtgatttggctggtcaagctccgctgaaagaaacacttgcggcggcg
gttgttttgcgctctggctggaaagcgggaacgccgctgattgatccaatgtgtggttca
ggaacgttattgatagaagcggcaatgatggccgcagatggcgctccaggtttgcatcgt
cagcattggggattcacatcatggctgaaattcgatcaagaaatctggcgtgaaatgatg
gctgaagcgcaggtacgtttccgtaaagggctacaggaaacgacttctcgcttttttggt
tcggatattgatcgtcgggtcatggatatggctcgctcaaatgcccgcagagcaggcgtt
gcccacttaattcagtttcaacaaggggatgcgagtaagctggaaaacccattgccggag
ggcgctgtgggaacaatactgagcaacccgccttatggcgaacgtcttgaaagtgagcca
gcactggttgccttgcacagcatatttggacgaataatgaaaagccgcttcccaggctgg
cgtctctcattattcagtgcttcgccagagttgttgagttgcctgcaactgcgcgctgaa
cgcgagtttaaggctaaaaatggcccactggattgtgtccagaaaaattatcaactttcg
gacaaaccgcaatcactggatgccggtattgcagatgattatgctaaccgtttgcgcaaa
aatgagaagaaactcagtaagtgggcaaagcagcagggtattgactgttatcgtttatat
gatgcagatttacccgaatacaacgttgcgattgatcgttatgcggacaaagttgtcgtt
caggaatacgcgccacctaaaaccgtagatgccaacaaagcccgccaacgcttattcgat
gtgatcagtgcaaccatgaatgtgctcgaattgtcatctaatcaactgatcctgaaaacc
cgccagcgtcaaacaggcaaaaatcaatatgaaaaaatggccgaaaagaaagaattcttt
ttggtgaacgaatatggtgcgaaattctgggtcaacttgacggattatctggataccggt
ctgtttcttgatcatcgtattgcccgcaaaaaattgggtgaaatgagccaagggaaagat
ttccttaacctgtttgcctatactggttcagcaacggtgcatgctggattaggcggtgcg
aggtctacgaccacggtggatatgtcccgtacttatcttgaatgggcagagaagaatcta
caggctaatggcttgtctggacgccagcatcgtttgattcaggctgattgtttgggatgg
ctggcgcaaagtcgcgagcaattcgatttgatctttatcgatcctccgacattttctaac
tctaagcgaatggaagactcattcgatgttcagcgtgatcacattccactcatgaaacag
cttaaatgtctgcttcgtcgtggcggaaccctgatgttctccaacaataagcgaggtttc
aaaatggactttgccgaacttgagaaattagggctggttgcggaagaaatcacagagaaa
acggtatctcaggattttgcccgtaaccgccagattcataactgctggctactgcgtcac
gctggcgaggaaaaataa

DBGET integrated database retrieval system