KEGG   Xenorhabdus bovienii CS03: XBW1_3589Help
Entry
XBW1_3589         CDS       T03845                                 

Gene name
cspE
Definition
(GenBank) Cold shock-like protein CspE
  KO
K03704  cold shock protein
Organism
xbv  Xenorhabdus bovienii CS03
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    XBW1_3589 (cspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB S1 CusF_Ec Rho_RNA_bind
Motif
Other DBs
NCBI-ProteinID: CDM90947
UniProt: A0A0B6XAP5
LinkDB All DBs
Position
complement(3423652..3423861)
Genome map
AA seq 69 aa AA seqDB search
MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQRVEFEITEGAKG
PSAANVVPI
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattaaaggtaacgttaagtggtttaatgaatctaaaggattcggttttatc
actccagaagatggtagcaaagatgtttttgtacacttttccgccattcagtctaacggt
ttcaaaactttggctgaaggtcaaagagtcgagtttgaaatcactgagggtgcgaaaggt
ccatctgctgcaaacgttgtcccaatctaa

DBGET integrated database retrieval system