KEGG   Xenorhabdus bovienii CS03: XBW1_4065Help
Entry
XBW1_4065         CDS       T03845                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha [Includes: Enoyl-CoA hydratase/Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase; 3-hydroxyacyl-CoA dehydrogenase]
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
xbv  Xenorhabdus bovienii CS03
Pathway
xbv00071  Fatty acid degradation
xbv00280  Valine, leucine and isoleucine degradation
xbv00281  Geraniol degradation
xbv00310  Lysine degradation
xbv00362  Benzoate degradation
xbv00380  Tryptophan metabolism
xbv00410  beta-Alanine metabolism
xbv00640  Propanoate metabolism
xbv00650  Butanoate metabolism
xbv00903  Limonene and pinene degradation
xbv00930  Caprolactam degradation
xbv01100  Metabolic pathways
xbv01110  Biosynthesis of secondary metabolites
xbv01120  Microbial metabolism in diverse environments
xbv01130  Biosynthesis of antibiotics
xbv01200  Carbon metabolism
xbv01212  Fatty acid metabolism
Module
xbv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XBW1_4065 (fadB)
   00650 Butanoate metabolism
    XBW1_4065 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XBW1_4065 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XBW1_4065 (fadB)
   00310 Lysine degradation
    XBW1_4065 (fadB)
   00380 Tryptophan metabolism
    XBW1_4065 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBW1_4065 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XBW1_4065 (fadB)
   00281 Geraniol degradation
    XBW1_4065 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XBW1_4065 (fadB)
   00930 Caprolactam degradation
    XBW1_4065 (fadB)
Enzymes [BR:xbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XBW1_4065 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XBW1_4065 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XBW1_4065 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     XBW1_4065 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CDM91418
UniProt: A0A0B6XF13
LinkDB All DBs
Position
3952860..3955046
Genome map
AA seq 728 aa AA seqDB search
MLYLSDTIQVNWLKDGIAELIFNAPAAINKLDTKTVASLDKAVAVLEQQTELKGLLLRSE
KQAFIVGADITEFLSLFDAPKEKLQEWLKFANDIFNCIEDLPVPTISAINGYALGGGCEV
VLSTDFRVASPDLRIGLPETKLGIMPGFGGSVRLPRLIGPDNALEIITAGKDIGAEDALK
NGLVDAVVPTEKLVDAAVSILEQAIKGDLDWQAARQPKLSPLNLNDVERTMSFTVAKGMV
MKVAGPHYPAPITAVKTIEKAATLGRDEALKLEAESFVPLAHTNVARALVGIFLNDQYVK
GLAKKHLKEVTVPQHATVLGAGIMGGGIAYQSARKGVPVLMKDINQKALDLGVNEAAKLL
HKQFERGRLDAMKMAKILSSIQPTLSYAGIEQSQIVVEAVVENPKIKAAVLAETESHIND
DCILASNTSTIPITELAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDKTISTVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLLRDGGDFRQIDKIMEKEFGWPMGPAYL
IDVVGIDTAHHAQAVMAQGFPERMTRDYHDAIDVLFENQRYGQKNDVGFYKYTQDKKGKP
KKEQDETVDQLLAGISQPKQVFSGEDIIARTMIPMINEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGVFRYLDTMGTAAYVKLAERYAHLGAMYHVPAGLKAKSESNESYYPVAAKI
AVNPGEKA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctacctaagtgacactattcaagtaaactggctgaaagatggcattgcagaactg
atcttcaatgcaccagctgcaattaataaattagatacaaaaaccgttgcttcattggat
aaagcggttgccgtccttgagcaacaaactgaattaaaagggctgttactacgttctgaa
aaacaagcctttattgttggggcagacatcacagaattcttatcattattcgatgcacca
aaagaaaaacttcaggaatggctgaagttcgccaatgatattttcaactgtattgaagat
ctccctgttcctactatttctgcgatcaacggctatgcacttggcggtggttgtgaggta
gtattgtcaactgactttcgtgttgcatccccagatcttcgcatcggattaccagaaact
aaattaggtattatgccgggctttggtggttctgttcgcctgccacgtttaattggccca
gataacgctctcgaaattattacagctggcaaagatattggtgcagaagacgcgctaaaa
aatggcctagttgacgccgttgtgccgactgaaaagctggtagatgctgctgtttctatt
ctggaacaggccatcaaaggcgatctggattggcaagccgcccgccaacctaaactttcc
ccactgaacctcaatgatgttgaacgcaccatgagcttcaccgtggcgaaaggaatggtg
atgaaagtcgcaggcccacactatccagcgccaattactgctgtaaaaactattgaaaaa
gcagcgacattgggtcgtgatgaagccttgaaactagaagcagaaagttttgttccactg
gctcataccaatgttgcccgtgccttggtcggcatcttcctgaatgaccaatatgtcaaa
ggtctggcgaaaaaacatctgaaagaagtcacagtgccacagcatgcaacggtactgggt
gcaggtatcatgggtggtggtatcgcctatcaatctgcacgcaaaggcgttcctgttctg
atgaaagacattaatcagaaagcgctggatttaggagtcaatgaagccgctaagttattg
cataagcaatttgagcgtgggcgtctggatgctatgaaaatggctaagattctgtcatcc
attcaaccaacactcagttatgcgggcattgagcaatctcagattgttgtcgaagccgtt
gttgagaatccgaagattaaagctgcggtcttggcagaaacagaatcacatatcaacgat
gattgcattctagcctccaatacctccacaatcccaatcactgaattagcaaagtcactg
aaacggccagaaaatttctgtggtatgcattttttcaacccagttcaccgtatgccgctg
gttgaaatcatccgtggagaaaaaacctcagacaagaccatttctactgttgtggcttac
gccagcaaaatgggtaaaacgccgattgttgtcaatgattgcccaggctttttcgtcaac
cgcgtattgttcccttatctggcaggcttcggcatgttactgcgcgatggcggtgatttc
cgtcaaatcgacaagatcatggagaaagagtttggctggccgatgggtcctgcatatctc
atcgacgttgttggcattgataccgcccatcatgctcaggcggtcatggcacaaggtttt
ccagagcgcatgactcgcgattatcacgatgccattgatgtattatttgaaaatcagcgt
tacggccagaaaaatgacgtgggtttctataaatacactcaagacaaaaaaggcaagccg
aaaaaagagcaggatgaaaccgtcgatcaactgctagcaggtatcagtcaaccgaaacag
gttttctctggcgaagatatcattgcccgtaccatgatcccgatgattaacgaagttgtt
cgctgcttggaagaaggtgtcattgccagtcctgcggaagcagatatggcgctggtttat
ggtttaggcttcccgccattccacggtggtgttttccgctatctggatacgatgggaacc
gcagcttatgtgaaactggctgaacgttatgcccacttaggcgcaatgtatcacgttccc
gctggcctgaaagcgaaatccgaaagcaatgaaagttactaccctgtcgcagccaaaatt
gctgttaatccaggtgaaaaagcgtga

DBGET integrated database retrieval system