KEGG   Xenorhabdus bovienii CS03: XBW1_4683Help
Entry
XBW1_4683         CDS       T03845                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
xbv  Xenorhabdus bovienii CS03
Pathway
xbv00260  Glycine, serine and threonine metabolism
xbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XBW1_4683 (tdh)
Enzymes [BR:xbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     XBW1_4683 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 FAD_binding_2 FAD_oxidored UDPG_MGDP_dh_N ELFV_dehydrog Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CDM92026
UniProt: A0A0B6XFJ5
LinkDB All DBs
Position
complement(4547325..4548350)
Genome map
AA seq 341 aa AA seqDB search
MKSLSKLKPEEGIWMADVPTPELGHNDVMIKIRKTAICGTDVHIYNWDDWSQKTIPVPMV
VGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRAGA
FAEYLVIPAFNAFKIPDNIPDELAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVSKENLTDVMKELGMTEGFDIGLEMS
GAPQAFRTLLSTMNHGGRIALLGIPPSDMAIDWNQVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLTPIITHQFSIDDFQKGFDIMRSGQSGKVILNWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattgtcaaaattaaagccagaagaaggtatttggatggcggatgtgcccaca
ccggaactggggcacaatgatgtgatgattaaaattcgcaagaccgccatctgtggtacg
gatgtgcacatctataactgggatgactggtctcagaaaacgattcctgtgccgatggtg
gtagggcacgaatatgtcggtgaagtggtcgcgattggtcaagaagtcaaagggttcaac
atcggtgaccgtgtgtctggtgaaggccacatcacctgtggtcattgccgtaactgccgg
ggtgggcgtacccacttgtgccgtaatacgaccggcgttggcgtgaaccgtgcgggtgca
tttgcggaatatctggttatcccggcatttaatgccttcaaaattccggacaatattcca
gatgaactcgccgctatttttgacccgtttggcaatgctgttcacactgcactgtctttt
gatctggtcggggaagatgtactggtatctggtgctggcccgattggtattatggcggct
gcggtgtgtaagcatgtcggcgcacgtcatgtcgtgattacagatgttaatgaatatcgg
cttgatttggcgcgtaaaatgggtgtcacccgtgccgtgaatgtcagtaaggaaaatctg
accgatgtcatgaaagaattaggcatgacagaaggttttgatatagggctggaaatgtca
ggtgcgccacaggcattccgcactttattgagtaccatgaaccacggtgggcgcattgcc
ctgttggggatcccaccttcagatatggcgatagattggaatcaggtcatctttaagggg
ctgtttatcaaagggatctatggccgtgaaatgttcgaaacatggtacaaaatggcggca
ttgatccagtctggtttagatctgaccccgattatcactcaccaattctcgattgatgat
ttccagaaaggctttgatatcatgcgttcagggcaatccggcaaagtgatcctgaattgg
gattaa

DBGET integrated database retrieval system