KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_0212Help
Entry
xcc-b100_0212     CDS       T00759                                 

Gene name
sod2
Definition
(GenBank) exported superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     xcc-b100_0212 (sod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAP49543
UniProt: B0RLV6
LinkDB All DBs
Position
245617..246264
Genome map
AA seq 215 aa AA seqDB search
MRILPTTLFLATALVLTACKRDEPAPAEPAPAPQAGTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNEVKGTVTFKTVDGALRVTGQLSGLKPNSEHGFHIHEKGDCSAPDGSSAG
GHFNPAQTDHGMVGADPHHGGDMPNIKADEQGNASIDGPVASNVNLGKADQSDIAGHAVI
VHADPDDYKTQPTGNAGGRLACGVITTDNAPAPTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcttcccactaccctgttcctggccaccgcgctggtcctgacggcctgcaaa
cgcgacgagcccgccccggccgaaccagcgcccgccccgcaggccggcaccccggccgaa
gccgcccacggcggcgagcatgccgcctcgatggtcaccgaggcggcggccaccaccacg
gccaccgccgagctcaaaccgaccaagggcaatgaggtcaagggcacagtcaccttcaag
accgtggacggtgcgctgcgggtcaccggccaactgagcgggctcaagcccaacagcgag
cacggcttccacatccacgagaagggcgactgcagtgcgccggacggcagcagcgccggc
ggccacttcaaccccgcccagaccgaccacggcatggtcggcgccgacccgcatcacggt
ggcgacatgcccaacatcaaggccgatgagcagggcaatgccagcatcgacggcccggtg
gcgagcaacgtcaacctgggcaaggccgaccagtccgacatcgccggccacgccgtgatc
gtccacgccgacccggacgactacaagacccagcccaccggcaacgccggcggccgcctg
gcctgcggcgtgatcaccaccgacaacgcgcccgcaccgaccaagtaa

DBGET integrated database retrieval system