KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_0244Help
Entry
xcc-b100_0244     CDS       T00759                                 

Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00473  D-Alanine metabolism
xca00550  Peptidoglycan biosynthesis
xca01100  Metabolic pathways
xca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    xcc-b100_0244
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    xcc-b100_0244
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    xcc-b100_0244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xca01011]
    xcc-b100_0244
Enzymes [BR:xca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     xcc-b100_0244
Peptidoglycan biosynthesis and degradation proteins [BR:xca01011]
 Precursor biosynthesis
  Amino acid ligase
   xcc-b100_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: CAP49575
UniProt: B0RLY8
LinkDB All DBs
Position
complement(274122..275228)
Genome map
AA seq 368 aa AA seqDB search
MRRIRVGLIFGGKSAEHEVSLQSARNILQALDPQRFEPVLIGIDKQGQWHLSAPESFLLD
ADDPSRIALRHSGRGLAVLPGAASAQLRAVDAEQALAQIDVVFPIVHGTLGEDGSLQGLL
RMANLPFVGSGVLGSAVAMDKDMAKRVLRDAGLEVAPFACFTRHTAAQADVQTLIAQFGL
PLFVKPANQGSSVGVSQVRSAEEFSAALELALRYDHKVLVEAAIAGREIECAVLGNATPQ
ASVCGEVVVHDAFYSYETKYIRDDGAATVIPADIDAHTQHRIQQCALQAYQALDCAGMAR
VDVFLCADGRIVINEVNTLPGFTRISMYPKLWEASGLDYRSLVTRLIELALERHADDGRL
YSSVVTHA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggattcgggtcggactcatctttggcggcaagtcggccgagcacgaggtctcg
ctgcaatcggcgcgcaacatcctgcaggcgctggacccgcagcggttcgagccggtgctg
atcggcatcgacaaacagggccagtggcacctcagcgcgccggagagttttctgctcgat
gccgacgaccccagccgcattgcgctgcgccacagcggccgcgggctggccgtgctgccc
ggtgccgccagtgcgcagctgcgcgcggtggatgccgaacaggcgttggcgcagatcgat
gtggtgttcccgatcgtgcacggcacgctgggcgaagacggctcgctgcaggggctgctg
cgcatggccaacctgccgttcgtcggttccggcgtgctggggtcggccgtggcgatggac
aaggacatggccaagcgggtgctgcgcgatgccggcctggaggtggcgccgttcgcatgc
ttcacgcgccacaccgctgcgcaggccgacgtgcaaacgctgattgcccaattcgggctg
ccgttgttcgtcaagccggccaaccagggctcgtcggtcggcgtcagccaggtccgcagc
gctgaggagttcagcgctgcattggagctcgcgctgcgctacgaccacaaggtgctggtg
gaagcggcgatcgccgggcgcgagatcgaatgcgcggtgctgggcaatgccacgccgcag
gccagcgtctgcggcgaggtggtggtgcacgacgcgttctattcgtacgagaccaagtac
atccgcgacgatggcgcagcgacggtgattcccgccgatatcgatgcccacacccagcac
cgtatccagcagtgcgcactacaggcctatcaggcgctggactgcgccggcatggcgcgc
gtggatgtatttctgtgcgcggatgggcgcatcgtcatcaacgaggtcaacaccttgccc
ggcttcacccgcatcagcatgtatcccaagttgtgggaggcaagcgggctggactatcgc
agcctggttacgcgcttgatcgagctggcactggagcggcatgccgacgatgggcgcctg
tacagcagcgtggtcacgcacgcgtga

DBGET integrated database retrieval system