KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_1220Help
Entry
xcc-b100_1220     CDS       T00759                                 

Definition
(GenBank) Penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    xcc-b100_1220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xca01003]
    xcc-b100_1220
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xca01011]
    xcc-b100_1220
Enzymes [BR:xca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     xcc-b100_1220
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     xcc-b100_1220
Glycosyltransferases [BR:xca01003]
 Polysaccharide
  Bacterial polysaccharide
   xcc-b100_1220
Peptidoglycan biosynthesis and degradation proteins [BR:xca01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   xcc-b100_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CAP50568
UniProt: B0RQ33
LinkDB All DBs
Position
1401820..1404264
Genome map
AA seq 814 aa AA seqDB search
MPRRYDHDAPDDFEDDSAEQGSRWQRRLIVWSLAAFALALGFLIPYTMYLNKQVTQRFGE
LRWQIPTRVYGRPLVLVPGKALDAATLKTELDAASYRDDGLGKLAGTYQQDGSRFVIASR
GYIDVDGQVPARRIEVALSAGRVASVRDAADRKALKSARLDPARIATLYGQKQEERRLVR
MEEVPELLVTGLQAVEDRDFNSHHGIDLSGMVRAAWIMARSGGQVRQGASTLTQQLARSG
LLGIGKEQTVTRKFNEILYAVIMEARYDKRTILEAYLNQVYLGQRGGQAVHGVSSGAELW
FGRELGSMTTEQVALLIGLVKGPSYYDPRRSPARALDRRNFVLGKLRENNLIDEAEYKRA
LAAPLGVPKEPGLVAANRFPAYVDLVRRQLAHDYPESVLQGAGMSVLTGMSPSAQAYAEG
AVTGTIKRLDNKKRPPLQAGLVLTDVHNGDVLAVVGSRDVAKPGFNRAVEAQRQVGSLLK
PFVYLLALASPDRWALSSWVDDSPVTVQLARGKTWSPGNSDNRSHGTVRLIDALAHSYNQ
ATVRVGMQVGPERVAQLIQVLAGIKAETNPSLILGATDQSPYGMAQLYQFLAAGGEIQPL
HAVRGVLDPQGKLLKRYDKTPAPAQEGDSVAANLISIGLQQVVSGGTARQLLGDGLGRLS
PAGKTGTSNDGRDSWYAGYTGDHLAVIWMGNDQNAETGLYGATGSMRVWSSIFARLPSAP
LKVSGKGLDWQWVDASGIGVTDAGCPGARQFPFVVGFTPAYASCAGNAPSIEEAPADGSA
PAEQSSGGGWRRFFGLDKKTETPAAAPASPPPAH
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgacgctacgatcacgacgctcccgacgatttcgaggacgactccgccgaacaa
ggctcccgctggcaacgcaggctgatcgtctggagcctggcggcattcgcgctggcgctc
ggtttcctgatcccgtacacgatgtatctgaacaagcaggtgacccagcgtttcggggaa
ctgcgctggcagatccccacgcgtgtgtacggccggccactggtgctggtgccgggcaag
gcgctggacgcagccacgctgaagaccgagctggacgcggcgtcctaccgtgatgacggg
ctgggcaagctggcgggcacctatcagcaggacggcagccgcttcgtgattgccagccgt
ggctatatcgacgtggacgggcaggtgccggcgcgtcggatcgaggttgcgctgtccgct
ggacgggtagccagtgtgcgcgatgcggccgaccgcaaggcgctcaagagcgcgcggctg
gatccggcacgcattgccacgctgtatggccagaagcaggaagagcgccgcctggtgcgc
atggaagaagtgcccgagctgctggtcaccggcctgcaggcggtggaagatcgcgatttc
aatagccaccacggcatcgacctgagcggcatggtgcgcgcggcctggatcatggcgcgc
tccggcggccaggtgcgtcagggtgccagcacgctgacccagcagctcgcgcgcagcggc
ctgctcggcatcggcaaggaacagacggtcacccgcaagttcaacgagatcctgtacgcg
gtgatcatggaggcgcgttacgacaagcgcaccatcctggaggcgtatctcaaccaggtg
tacctgggccagcgcggcgggcaggccgtacatggcgtgtcgtccggtgcagagctgtgg
ttcggccgcgagctgggctcgatgaccaccgaacaggtcgcgctgctgatcggcctggtc
aaggggccgtcgtattacgacccgcgacgcagccccgcacgcgcgctggaccggcgcaac
ttcgtgctgggcaaactgcgcgagaacaatctcatcgacgaggccgagtacaagcgcgcg
ctggccgcgccgctcggcgtgcccaaagagccgggcctggtcgccgccaatcgcttcccg
gcctacgtggacctggtgcgccggcaactggcgcatgactacccggaaagcgtgctgcaa
ggcgctggcatgagcgtgctcaccggcatgtcgccgtctgcgcaggcgtatgccgaaggt
gcggtgaccggcaccatcaagcggctggacaacaagaagcgcccgccgttgcaggccggc
ctggtgctgaccgacgtgcataacggcgatgtgctggcggtggtcggcagccgcgacgtg
gccaagcccgggttcaaccgcgccgtggaagcgcagcgccaggtcggctcgctgctcaag
cccttcgtctacttgctggcactggcctcgcctgaccgttgggcgttgtccagctgggtc
gacgattccccggtgaccgtgcagcttgcgcgcggcaagacctggtcgcccggcaattcg
gacaaccgcagccatggcacggtgcgcctgatcgatgcgctggcgcattcgtacaaccag
gccacggtgcgggtgggcatgcaggtgggtccggagcgcgtggcgcagctgatccaggtg
ctggccggcatcaaggccgagaccaatccttcgttgatcctgggcgctaccgaccagagc
ccgtatggcatggcgcagctgtaccagtttctggccgccggtggcgagatccagccgcta
catgcggtgcgcggcgtgctcgatccgcagggcaagttgctcaagcgctacgacaagacc
ccggcgcctgcgcaggaaggcgattcggtcgccgccaacctgatcagcatcggtctgcag
caggtggtcagcggtggtaccgcgcgccagttgctcggcgatggcctggggcggttgtcg
ccggccggcaagaccggcacctccaacgatggccgcgacagctggtatgccggctatacc
ggcgaccatctggcggtgatctggatgggcaacgaccagaacgccgaaaccggtctgtat
ggtgccaccggctcgatgcgggtgtggtcgagcatctttgcgcggctgccaagcgcgccg
ttgaaggtcagcggcaagggcctggattggcagtgggtggacgccagcggcatcggcgtg
accgatgcgggttgccccggtgcgcgccaattcccgttcgtggtcggcttcacccccgca
tacgcgtcgtgcgccggcaacgcaccgtccatcgaagaggcgcctgccgacggcagcgca
ccggccgagcaatccagcggcggcggctggcgccggttcttcggtctggacaagaagacc
gaaacgcccgcggccgcacctgcctcgcccccacctgcgcactga

DBGET integrated database retrieval system