KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_1289Help
Entry
xcc-b100_1289     CDS       T00759                                 

Definition
(GenBank) HSP33 family chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
KEGG Orthology (KO) [BR:xca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xca03110]
    xcc-b100_1289
Chaperones and folding catalysts [BR:xca03110]
 Heat shock proteins
  HSP33
   xcc-b100_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: CAP50639
UniProt: B0RQA4
LinkDB All DBs
Position
complement(1499254..1500144)
Genome map
AA seq 296 aa AA seqDB search
MTDHDQLSRFLLPAAGVRGVHVRLTQAWRDIQGAAHYPPFARQLLGEAAVASALFTGHTK
VDGRLSVQLRGNDRLRTLFAECTAAGTLRGIVQIADGADAPTDLRELGDDALLAITIENP
GLDPREPQRYQSLVGMQAPDLAEAFETYFLQSEQLPTRLLLAAGPDQAAGLLLQKLPGDE
GDTDGWTRVGALFDTLGAPELLSVAGEDLLHRLFHEEAPELVGNKALSFGCSCSRERVAA
MLQSLGEDEARAAAEPTGEVEVRCEFCGREYHFPLTELDVLFSEAQPSQDAPERLQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgatcagctttcccgtttcctgttgcctgccgccggcgtgcgtggcgtg
catgtgcgtctgacccaggcctggcgcgacatccagggcgctgcccactacccgccattt
gcacgacagttgcttggcgaagccgcagtcgcgtccgcgctgttcaccggccacaccaag
gtagacggcaggctgtcggtgcagttgcgcggcaatgaccgcctacgcacgctgtttgcc
gaatgcaccgctgccggcaccttgcgcggcatcgtccagatcgccgacggtgccgatgcg
cccaccgatctgcgcgagctcggcgacgacgccctgctggccatcaccatcgagaacccc
ggcctggacccgcgcgaaccgcagcgctaccagagcctggtgggcatgcaggcgccggat
ctggccgaagcgttcgaaacctacttcctgcagtccgagcagctgcccacccgcctgctg
ctggccgccgggcctgaccaggctgcgggcctgttgctgcaaaagctgcccggcgacgaa
ggcgacaccgacggctggacccgcgtcggcgccctgttcgacaccctgggcgccccggaa
ctgctttcggtcgccggcgaagacctgctgcatcgtctattccatgaagaagcgcccgaa
ctggtgggcaacaaggcgctaagcttcggctgttcctgctcacgcgagcgcgtcgccgca
atgctgcagtcgctgggcgaagacgaagcgcgcgcggcggcggagccgactggggaagtc
gaggtgcggtgcgagttctgcgggcgtgagtatcacttcccgttgaccgagctggacgta
cttttcagcgaggcgcagccatcgcaggatgcgccggaacggttgcagtag

DBGET integrated database retrieval system