KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_1845Help
Entry
xcc-b100_1845     CDS       T00759                                 

Gene name
gst2
Definition
(GenBank) putative glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    xcc-b100_1845 (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xca02000]
    xcc-b100_1845 (gst2)
Enzymes [BR:xca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     xcc-b100_1845 (gst2)
Transporters [BR:xca02000]
 Other Transporters
  Pores ion channels [TC:1]
   xcc-b100_1845 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: CAP51198
UniProt: B0RRW3
LinkDB All DBs
Position
complement(2162388..2163002)
Genome map
AA seq 204 aa AA seqDB search
MHSDRHITLFHNPQSRSRGVLVLLEELGADYSLQRLDLERGDQRDAAFLAINPMGKIPAI
THGDSVVTEQAAIYQYLAELYPDAGLSPAPGDPDRGAYLRWLAFYGSAFEPALIDKAMKR
DAPPRSLSPWADFPTVLAVVDAQLAKGDYLLGARCSAADVLWGSALGWMAGFKMIDPPAP
TLAYIARMAARPAVARAAAVDAGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcgaccgccacatcaccctgttccacaatccgcaatcgcgctcgcgcggagtc
ctggtgctgctggaggaactgggcgccgactacagcctgcagcggctggatctggagcgc
ggcgaccagcgcgatgccgcgttcctggcgatcaacccgatgggcaagattccggcgatc
acgcatggcgacagcgtggtgaccgaacaggcggcgatctaccaatacctggccgagctg
tacccggacgccgggctgtcgcctgcgccgggcgacccggaccgcggcgcctatctgcgc
tggctggcgttctacggctcggctttcgagccggccctgatcgacaaggccatgaagcgc
gatgcaccgccacgctcgctatcgccatgggcagacttccccaccgtgctggcggtggtg
gatgcccagctggccaagggcgactatctgctcggcgcgcgttgttccgccgccgacgtg
ctgtggggcagcgcgctgggctggatggccggcttcaagatgatcgacccacctgccccg
accctggcctacatcgcacgcatggccgcgcggccagcggtggcgcgggccgcggcggtc
gatgccggcgcctga

DBGET integrated database retrieval system