KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_3518Help
Entry
xcc-b100_3518     CDS       T00759                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xca  Xanthomonas campestris pv. campestris B100
Brite
KEGG Orthology (KO) [BR:xca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    xcc-b100_3518 (ahpF)
Enzymes [BR:xca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     xcc-b100_3518 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Glutaredoxin NAD_binding_7 AlaDh_PNT_C FMO-like NAD_binding_8 Thioredoxin_4 Thi4 K_oxygenase Spermine_synth
Motif
Other DBs
NCBI-ProteinID: CAP52883
UniProt: B0RUE1
LinkDB All DBs
Position
3989938..3991527
Genome map
AA seq 529 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQIHASIDDTPKAREMLELLEDLVLLSDKISLDVHRDDNQ
RKPSFALTTPGQDISVRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGALFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADG
LVEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDTQHIDLEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADVAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtcacgcggccg
atccagatccatgcctcgatcgacgacacccccaaggcgcgcgagatgctcgagctgctc
gaggatctggtgctgctctcggacaagatcagcctggacgtgcaccgcgacgacaatcag
cgcaagccctcgttcgcgctgaccacgccgggccaggacatttcggtgcgctttgccggc
ctgccgatggggcacgaattcacctcgctggtgctggcgctgctgcaggtcggcggccac
ccttccaaggccactgccgagctgatcgagcaggtgcagcatctggatggcgactaccag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtgctgaacccgcgcatcaagcacgtggccatcgatggcgcgctgttccag
gacgaggtggaaacccgccagatcatgtcggtgcccaccgtgtacttgaacggtgaactg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaatgcagcc
aagcgcgatgccgccaagatcgcagccaaggaggccttcgacgtgttggtggtcggcggt
ggcccggccggctcggcagcagcggtctatgccgcacgcaagggcatccgcaccggcgtg
gctgcagagcgtttcggtggtcaggtgctggacaccatgtcgatcgaaaacttcatctcg
gtgccggaaaccgaaggcccgaagatggctgccgcgcttgagcagcacgtgcgccagtac
gaggtggacatcatgaatctgcagcgtgccgagcagctgatcccggccggtgccgatggc
ctggtcgaaatcaagctggccaatggcgcatcgctcaagagcaagacggtgatcctgtcc
accggcgcgcgctggaggcagatgaatgtgccaggcgaagaccagtacaagaacaagggc
gtggcctactgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgacgaagtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctgggcgatggt
cagaaggtcaccggcctggtctacaaggaccgcaccggcggcgatacgcagcacatcgac
ctggaaggtgtgttcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtggagttgtccccgcgcggcgagatcatcgtcgacgaccgcggccagaccaatgtgccg
ggcgtgttcgcggccggcgacgcgaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaggctgcgctgagcgcgttcgattacctgatccgctccagcgcaccg
gtcagcgccgacgtggcccaggctgcgtaa

DBGET integrated database retrieval system