KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_3543Help
Entry
xcc-b100_3543     CDS       T00759                                 

Gene name
betB
Definition
(GenBank) betaine-aldehyde dehydrogenase
Organism
xca  Xanthomonas campestris pv. campestris B100
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Peptidase_M75
Motif
Other DBs
NCBI-ProteinID: CAP52908
UniProt: B0RUG6
LinkDB All DBs
Position
4012817..4014286
Genome map
AA seq 489 aa AA seqDB search
MEALAATLRGIAARGPWGLFIDGQWRASTGSQTLDVIAPHTEERLLRYTEPSHADTEAAV
AAARRAFDSGPWPQLPPPERGAALKRIAEHLRARMPELADAWTAQVGATIGFSRRASKQA
PDLFDYYGDLITTHPFVEPRTRSSGGRVHVVQEPVGVVVAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGLPDGVFNLLPAGREVGEQLIRHPSVDKVSFTG
STQAGRSIGVACAERLARVGLELGGKSAAIVLEDADIEKVLPSLVPYSMPITGQVCFALT
RVLVPAHRREAILHAYCSALATLKLGEPFAADTGMGPLALGRQLERVQGYIAQGSAEGAK
LVMGGGRPEHLPRGFFLEPTVFAGVTPEMTIAREEIFGPVVSFIDYHNEEDLIAKVNDSD
YGLHGTVYSDDPERAYAIARRVRSGSHSINGMCVDIEMPFGGVKHSSIGREGGIEGLHGF
LETKTIYLG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttagccgcgaccctgcgtggcatcgccgcgcgtggaccgtggggtttattc
atcgatggtcagtggcgcgccagcaccggcagccagacgctggatgtcatcgcgccgcac
accgaagaacgcctgctgcgctacaccgaaccatcgcatgccgacaccgaggccgcggtt
gccgcggcgcgcagagccttcgatagtggcccctggccgcagctgccgccgccagaacgc
ggcgccgcgctcaagcgcattgccgagcatttgcgggcgcgcatgccggaactggcagat
gcatggaccgcgcaggtcggcgccaccatcggtttcagtcggcgcgcctccaagcaggcg
ccggatctgttcgactactacggcgacctgatcaccacccacccgttcgtcgagccacgc
acgcgctccagcggcgggcgcgtgcatgtggtacaggaaccggtcggcgtggtcgtcgcc
atcacgccgtggaatgcgccgttggtgctgctctgctacaaggtcgccgccgcgctggcg
gccggctgcacggtggttgccaagccgtctccggaaacgccgatcgacgcctatattctg
gccgaatgcatcagcgccgccgggctgccggatggcgtgttcaatctgctaccggccggg
cgcgaggtgggtgaacagctgatccggcacccttcggtggacaaggtgagcttcaccggc
tccacccaggcagggcgatcgatcggtgtggcctgcgccgagcgcctggcgcgcgtcggg
ctggagctgggcggcaagtcggcggcgatcgtgctggaggatgccgacatcgagaaagtg
ctgcccagcctggtgccctactcgatgccgatcaccggccaggtgtgtttcgcgctcacc
cgcgtactggtccccgcgcatcggcgcgaggccatcctgcacgcgtattgctcggcgctg
gccacgctcaaactcggcgaaccgtttgccgccgacacgggcatgggcccgctggcactc
ggccgccagttggaacgtgtgcaaggctacatcgcccagggcagcgccgaaggcgcaaag
ctggtcatgggcggcgggcggccagagcacttgccacgcggtttctttcttgagccgacc
gtgtttgcaggtgtgacgccggagatgaccattgcccgcgaagaaatcttcggccccgtc
gtgagttttatcgactatcacaacgaagaagatctgatcgccaaagtcaacgacagcgat
tacggcctgcatggcaccgtctatagcgacgatcccgaacgcgcctacgcgattgcgcga
cgcgtgcggagcggcagccattcgatcaacggcatgtgcgtggatatcgagatgccgttc
ggtggtgtcaaacactccagcatcggccgcgaaggtggcatcgaaggcctgcacgggttt
ctcgaaaccaaaacgatctatctcggctaa

DBGET integrated database retrieval system