KEGG   Xanthomonas campestris pv. campestris B100: xcc-b100_4328Help
Entry
xcc-b100_4328     CDS       T00759                                 

Gene name
bga1
Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
xca  Xanthomonas campestris pv. campestris B100
Pathway
xca00052  Galactose metabolism
xca00511  Other glycan degradation
xca00600  Sphingolipid metabolism
xca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    xcc-b100_4328 (bga1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    xcc-b100_4328 (bga1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    xcc-b100_4328 (bga1)
Enzymes [BR:xca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     xcc-b100_4328 (bga1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: CAP53698
UniProt: B0RZ12
LinkDB All DBs
Position
complement(4899678..4902572)
Genome map
AA seq 964 aa AA seqDB search
MTPAVMQQQATTTAQRVSERGVSVAMTCAIHHLRGVLHRLCRRARDGRPGTTQQPLQRSL
RAGCMALICLCTTAGVVTAAEPTNAPRERLSLNADWRFQRGDPPGTTVRLEYDVRPEVVR
SEDGKVADARPEQAQHIDADARDVLKPWVLPTANNLIADPTQRHVRPPGHPGSAVAYVQP
MFDDSAWQRVDLPHDWAIAGPFLADGPHGGMGRLPSWGVGWYRKALQIPASDRGRSLFLD
LDGAMSYATVWLNGKLVGGWPYGYTSWRVDLTPYVVPGGHNQLAIRLDNPPDSARWYPGG
GLYRNVWLTKTGPLRVAQWGTQLSTPQVSAERAQVQLAVQLDNAGAAPVQAQVSTALYAL
DDASGLRRGPAVAQIAAVQVQVAAGGSARVQGSTQIEAPRRWGPPPTQQPHRYVAVTEVS
QGGRVVDRVETPFGVRSVVFDPDKGLVINGEHVPIRGVNNHHDLGALGAAFNVRAAERQL
QLLQQMGANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLIFPQWHEP
DLRAMLRRDRNHPSIILWSVGNEVGEQYTGEAGAAIARRLHAIVHAEDPTRPATAAMNYA
SPEMPLPAALDVISLNYQGEGIRDTPEFEGTERIRKLPQYPAFHAKFPRKAILSSETASA
LSSRGVYLFPVSAQSSAPVRDGRGGDSVAHQVSAYELHAVDFGSSADKVFAALDRHPFVA
GEFVWTGFDYLGEPTPYYSSRSSYSGILDLAGFPKDRYWLYQARWRPELPMAHLLPHWSW
PGREGQVTPVHVFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELRVQAYKNG
KPWASDRVQTAGRAKRMQLSADRTQIHGDGKDLSFITVRLLDADGRPAPTAGDRLRFRVE
GAGELVATDNGDPTNLEAFGLPERNAFNGLCLVIVRAKPGAQGPITVHVQSDTLQPASVQ
VLAE
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagccgttatgcagcagcaggcaaccacgaccgcacagcgcgtgagcgagcgc
ggtgtaagcgtggcgatgacctgcgccatccatcacctacggggtgtgctgcatcgcctc
tgcaggcgtgcacgcgatgggcgcccaggcactacgcagcagccgctgcagcgcagcctg
cgcgctggatgcatggcgctgatctgcctctgcactaccgcaggtgtggtcacagcggcg
gagccaaccaacgcgccgcgcgaacggctctcgctcaacgccgactggcgcttccagcgc
ggcgatccaccgggcactaccgtgcggctggagtacgacgtacgcccggaggtggttcgc
agcgaagacggcaaggtggccgatgcgcggcccgagcaggcgcaacacatcgacgccgac
gcgcgcgacgtcctcaaaccgtgggtcctgccgactgccaacaacctgatcgccgacccc
acgcagcggcatgtgcgcccgcccgggcacccgggcagtgcagtggcctacgtgcagccc
atgttcgacgacagcgcatggcagcgtgtggacctgccacacgattgggcaattgcaggg
ccgttcctggccgatggcccgcatggcggcatggggcgattgccgagctggggcgttggc
tggtatcgcaaggcgctgcagattccggccagcgaccgcggccgctcgctgtttctcgat
ctcgatggcgcgatgtcctacgccaccgtctggctcaacggcaagctggtgggcggctgg
ccgtatggctacaccagctggcgcgtggatctcacgccgtatgtggtgccgggcgggcac
aaccagctcgcgatccggctggacaacccgcctgattcggcgcgttggtatcccggcggt
ggcctgtatcgcaatgtctggttgaccaagaccggcccgctccgcgttgcccagtggggc
acgcagctgagcacgccgcaggtgtcggccgagcgcgcgcaggtgcagctggcggtgcag
ctggacaatgccggtgccgcccccgtgcaggcgcaggtgagcaccgcgctgtacgcgctg
gatgacgccagcgggctgcgccgtggcccggcggtggcgcagatcgccgcggtgcaggta
caggtggcggcgggtggcagtgcacgcgtgcagggcagtacgcagatcgaggcgccacgg
cgttggggcccgccaccgacacagcaaccgcatcgctatgtcgcggtgaccgaggtcagc
cagggtgggcgcgtggtcgatcgtgtcgaaacgccgttcggcgtgcgcagcgtggtcttc
gacccggacaagggcttagtcatcaacggcgaacacgtgcccatccgcggggtcaacaac
catcacgatctgggcgcgctgggggccgcgttcaacgtgcgcgccgccgagcggcagctg
cagttactgcaacagatgggcgccaatgccatccgcatgagccacaacccgcccgcgccg
gaattgctggagctcaccgaccgcatgggcctgctggtggtggacgaggtgttcgacagc
tgggagatgaaaaagaccccgctggatttccacctgatctttccgcagtggcacgagccg
gatctgcgcgccatgctgcgccgcgaccgcaaccatccctccatcattttgtggagcgtg
ggcaacgaagtgggcgagcaatacaccggcgaagcgggtgccgcgatcgcgcgcaggctg
cacgccatcgtgcacgccgaagaccctacgcgcccggcgacggcggcaatgaactacgcc
tcgcccgagatgccgctgccggcggcgctggatgtgatcagcctcaactaccagggcgaa
ggcatccgcgatacgcccgagttcgaaggcaccgagcgcatccgcaagctgccgcaatac
ccggccttccatgccaaattcccgcgcaaggccatcctcagcagcgagacggcctcggcg
ctgagcagccgcggggtgtacctgtttccggtgagtgcgcagagcagcgcgccggtgcgc
gatggccgcggcggcgattcggtggctcaccaggtcagcgcgtatgagctgcacgcggtg
gatttcggctccagtgccgacaaggtctttgccgcgttggatcggcatccgttcgtggcc
ggcgagtttgtgtggaccggcttcgactatctcggcgagcccacgccgtactacagctca
cgcagttcctattccggcattctggatctggctggcttccccaaggaccgctactggctg
taccaggcgcgctggcggccggaactgccgatggcgcacctgctgccgcactggagctgg
ccggggcgcgagggccaggtgacgccggtgcacgtgttcacctccggcgacgaggccgag
ctattcgtcaacggcgtctcgcaaggccgcaagcgcaaggcaccgttgcagtaccggctg
cgctgggatgcggtggtctaccaaccgggcgagctgcgcgtgcaggcctacaaaaatggc
aagccgtgggccagcgaccgtgtgcagaccgccggccgcgccaagcgcatgcagctcagc
gccgatcgcacccagatccatggcgatggcaaggacctgagtttcatcaccgtgcgcctg
ctcgatgccgacgggcgccctgcaccgactgcaggtgaccgcttgcgattccgcgtggaa
ggcgcaggcgaactggtcgccaccgacaacggtgacccgaccaacctggaggccttcggc
ctgcccgagcgcaacgccttcaacggtctgtgcctggtgatcgtgcgcgccaagccaggc
gcgcaggggccgatcaccgtgcatgtgcaatccgacacgctgcagcctgccagcgtgcag
gtgctggcggaatga

DBGET integrated database retrieval system