KEGG   Xanthomonas campestris pv. campestris 8004: XC_0031
Entry
XC_0031           CDS       T00247                                 

Definition
(GenBank) glutamate synthase, beta subunit
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00250  Alanine, aspartate and glutamate metabolism
xcb00910  Nitrogen metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    XC_0031
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XC_0031
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     XC_0031
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 NAD_binding_7 2-Hacid_dh_C FMO-like FAD_binding_3 HI0933_like AlaDh_PNT_C Thi4 DAO FAD_oxidored NAD_binding_9 FAD_binding_2 GIDA Lycopene_cycl Amino_oxidase 3HCDH_N zf-HIT
Other DBs
NCBI-ProteinID: AAY47125
UniProt: A0A0H2X3N0
LinkDB
Position
complement(38001..39482)
AA seq 493 aa
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGKFDKADAQYQSGRCLDCGNPYCSWK
CPVHNAIPQWLQLVQEDRIIEAAALCHSTNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTI
GAVEKYIVDTAFSMGWRPDLGNVQPSGHRVAVVGAGPAGLSCADRLVRAGIEAVVYDRYE
QIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGKDVSIEQLLGEYDAVFLGT
GAYRYTDGGLDGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQIALPDLNGKRVV
VLGGGDTGMDCVRSAIRLGAAKVTCAYRRDESSMPGSAREVANAREEGVRFLFNRQPLSI
ESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLLEADVVIIAFGFSPTVPEWLSS
QGVEAGSNGRIVAPAEGNGRLPYQTSNPRLFAGGDCVRGADLVVTAVAEGRDAAGSIVQL
LGVKAQVKEPAAA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagccgcaagcaagccttccaattccttgacctgccgcggaccatgcccacgcgcatc
ccggtggagctgcgtacgtccggtgactggggcgagttgtacggcaagttcgacaaggcc
gacgcgcagtaccagtccggccgctgtctggattgcggcaacccgtactgcagctggaag
tgcccggtgcacaacgccattccgcagtggctgcagctggtgcaggaagatcgcatcatc
gaggccgccgcgctgtgccattccaccaacccgctgccggaagtgtgcgggcgcgtgtgt
ccgcaggaccgtctgtgcgaaggcagctgcacgctggaagaattcggcgcggtcaccatc
ggcgcggtggaaaagtacatcgtcgataccgccttcagcatgggctggcgcccggacctg
ggcaacgtgcaacccagcggccaccgcgtggccgtggtcggcgccggcccggcaggcctg
tcctgcgcggaccgcctggtgcgcgccggcatcgaagcggtggtctacgaccgctacgaa
cagatcggcgggctgctgcagttcggcattcctagcttcaagctggacaagtcggtgatc
ggcaagcgccgcgagatcctggaaggcatgggcgtgcagttccgcctgggcgtggagatc
ggcaaggacgtcagcatcgaacagttgctcggcgaatacgacgccgtgttcctgggcacc
ggcgcgtaccgctacaccgacggcgggctggacggccaggacctgaagaacgttttgcca
gcgttgcccttcctggtgcagaacagccgcatcgtcagcggcaacgacccgcacggccgg
ccgatcgccggctgggaagaccagatcgccctgcccgacctcaacggcaagcgcgtggtg
gtgctgggcggcggcgacaccggcatggactgcgtgcgcagcgccatccgcctgggcgcg
gccaaagtcacctgtgcctaccgccgcgacgaatccagcatgccgggctcggcgcgcgaa
gtggccaacgcgcgcgaagaaggcgtgcgcttcctgttcaaccgccagccgctgtcgatc
gagtccggcgccgacgacgaagccatcggcgtgaccgtggtggaaaccaaactcggcgag
cccgacgccagcggccgccgcaacgcggtgccggtggaaggcagcgaatcgttgctggaa
gcggacgtggtgatcatcgcgttcggcttctcgccgacggtgccggagtggctgtcctcg
caaggcgtggaggccggcagcaacggtcgcatcgtcgccccggccgagggcaacggccgc
ctgccctaccagaccagcaacccccgcctgttcgccggtggcgactgcgtgcgcggcgcc
gacctggtggtcaccgccgtggccgaaggccgcgatgcggccggcagcatcgtgcagctg
ctgggtgtcaaagcgcaggtcaaggagccggctgcggcgtga

DBGET integrated database retrieval system