KEGG   Xanthomonas campestris pv. campestris 8004: XC_0104Help
Entry
XC_0104           CDS       T00247                                 

Definition
(GenBank) chloroacetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00620  Pyruvate metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_0104
   00620 Pyruvate metabolism
    XC_0104
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XC_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AAY47195
UniProt: A0A0H2X2G0
LinkDB All DBs
Position
122952..124481
Genome map
AA seq 509 aa AA seqDB search
MNALPSAKSLNTDPQSIFKPRYDNFIGGAWVAPQGGQYFDNTTPITGKVFTSIARSTAPD
IEAALDAAHAAKEAWGKTSTTDRSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDTFMEKALKRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEILIGGERNMLDGELSDGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
EALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttccttccgccaagtccctcaacaccgacccgcaatccatcttcaaacca
cgctacgacaacttcatcggcggggcgtgggtggcgccgcagggtggtcagtatttcgac
aacaccacgccgatcactggcaaggtgttcacttcgatcgcgcgctctaccgcgccagat
atcgaagccgcattggacgccgcgcacgcggccaaggaggcgtggggcaagacctccacc
accgatcgctccaacgtgctgctcaagatcgccgaccgtatcgagcagaacctggaattg
ctggcctacgccgagacctgggacaacggcaaaccggtacgcgaaacgctcaatgcggac
gtgccgctatgcgtggaccacttccgctatttcgccggtgccatccgcgcgcaggaaggc
ggcatctccgagatcgacagcgacaccattgcctatcatttccacgagccgctcggcgtg
gtcgggcaaatcatcccgtggaatttcccgctgctgatggcctgctggaaactcgcgccc
gccctggccgccggcaactgcgtggtgatgaagccggccgagcagaccccggcctcgatc
ctggtgctgatggaggtgatcggcgatctcctgccgcccggcgtgctcaacgtagtgaac
ggcttcgggcttgaggcaggcaagccgctggccagcaatccgcgcatcgccaagatcgcc
ttcactggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatc
ccggtgacgctggagctgggcggcaaatcgcccaacatcttctttgccgatgtcatggcc
gaagacgatgactttctcgacaaggcagtggaaggtttcgtgctgtttgccttcaaccag
ggcgaggtctgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgacacattc
atggaaaaggcgctcaagcgcgtggccgcgatcaagcagggcaacccgctggatcccaac
accatggtcggcgcgcaggcttccagcgagcagctggagaagattctgtcctacatcgac
ataggcaagcaggagggcgccgaaatcctgatcggtggcgagcgcaacatgctcgacggg
gagctatcggatggtttctatgtcaagccgaccgtgttcaagggccacaacaagatgcgc
gtgtttcaggaagaaatcttcggcccggtggtgtcggtgaccaccttcaaggacgaggcc
gaagccctggcgatcgccaacgacaccttgtacggattgggcgccggcgtgtggagccgc
gatgcctcgcgcctgtaccgcatgggccgcgcgatccaggccggccgcgtgtggaccaac
tgctaccacgcctatcccgcgcatgccgcgttcggtggctacaagcagtcgggcatcggc
cgcgaaaaccacaagatgatgctcgaccattaccagcagaccaagaacctgctggtgagc
tattcgccgaaggcgctggggttcttctga

DBGET integrated database retrieval system