KEGG   Xanthomonas campestris pv. campestris 8004: XC_0201Help
Entry
XC_0201           CDS       T00247                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XC_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 CHRD
Motif
Other DBs
NCBI-ProteinID: AAY47288
UniProt: A0A0H2X434
LinkDB All DBs
Position
250086..250583
Genome map
AA seq 165 aa AA seqDB search
MVTEAAATTTATAELKPTKGNEVKGTVTFKTVDGALRVTGQLSGLKPNSEHGFHIHEKGD
CSAPDGSSAGGHFNPAQTDHGMVGADPHHGGDMPNIKADAQGNASIDGPVASNVNLGKAD
QSDIAGHAVIVHADPDDYKTQPTGNAGGRLACGVITTDNAPAPTK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgaagcagcggccaccaccaccgctaccgccgagctcaagccgaccaagggc
aatgaggtcaagggcacagtcaccttcaagaccgtggacggcgcgctgcgggtcaccggc
caactgagtgggctcaagcccaacagtgagcacggcttccacatccacgagaagggcgat
tgcagtgcgccggacggcagcagcgccggcggccacttcaaccccgcccagaccgaccac
ggcatggtcggcgccgacccgcatcacggtggcgacatgcccaacatcaaggccgatgcg
cagggcaatgccagcatcgacggcccggtggcgagcaacgtcaacctgggcaaggccgac
cagtccgacatcgccggccacgccgtgatcgtccacgccgacccggacgactacaagacc
cagcccaccggcaacgccggcggccgcctggcttgcggcgtgatcaccaccgacaacgcg
cccgcaccgaccaagtaa

DBGET integrated database retrieval system