KEGG   Xanthomonas campestris pv. campestris 8004: XC_0232Help
Entry
XC_0232           CDS       T00247                                 

Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00473  D-Alanine metabolism
xcb00550  Peptidoglycan biosynthesis
xcb01100  Metabolic pathways
xcb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XC_0232
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XC_0232
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    XC_0232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
    XC_0232
Enzymes [BR:xcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XC_0232
Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
 Precursor biosynthesis
  Amino acid ligase
   XC_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: AAY47319
UniProt: A0A0H2X4B0
LinkDB All DBs
Position
complement(279629..280750)
Genome map
AA seq 373 aa AA seqDB search
MTGAGMRRIRVGLIFGGKSAEHEVSLQSARNILQALDPQRFEPVLIGIDKQGQWHLSAQE
SFLLDADDPSRIALRHSGRGLAVLPGAASAQLRAVDAEQALAQIDVVFPIVHGTLGEDGS
LQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDAGLEVAPFACFTRHTAAQADVQTLI
AQFGLPLFVKPANQGSSVGVSQVRSAEEFSAALELALRYDHKVLVEAAIAGREIECAVLG
NATPQASVCGEVVVHDAFYSYQTKYIRDDGAATVIPADIDAHTQHRIQQCALQAYQALDC
AGMARVDVFLCADGRIVINEVNTLPGFTRISMYPKLWEASGLDYRSLVTRLIELALERHA
DDGRLYSSVVTHA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagcaggcatgcgcaggattcgggtcggactcatctttggcggcaagtcggcc
gagcacgaggtctcgctgcaatcggcgcgcaatatcctgcaggcgctggacccgcagcgg
ttcgagccggtgctgatcggcatcgacaaacagggccagtggcacctcagcgcacaagag
agtttcctgctcgatgccgacgaccccagccgcattgcgctgcgccacagcggccgcggg
ctggccgtgctgcccggtgccgccagtgcgcagctgcgcgcggtggatgccgaacaggcg
ttggcgcagatcgatgtggtgttcccgatcgtgcacggcacgctgggcgaagacggctcg
ctgcaggggctgctgcgcatggccaacctgccgttcgtcggttccggcgtgctggggtcg
gccgtggcgatggacaaggacatggccaagcgggtgctgcgcgatgccggcctggaggtg
gcgccgttcgcatgcttcacgcgccacaccgctgcgcaggccgacgtgcagacgctgatt
gcccaattcgggctgccgttgttcgtcaagccggccaaccagggctcgtcggtcggcgtc
agccaggtccgcagcgctgaggagttcagcgctgcattggagctcgcgctgcgctacgac
cacaaggtgctggtggaagcggcgatcgccgggcgcgagatcgaatgcgcggtgctgggc
aatgccacgccgcaggccagcgtgtgcggcgaggtggtggtgcacgacgcgttctattcg
taccagaccaagtacatccgcgacgatggcgcagcgacggtgattcccgccgatatcgat
gcccacacccagcaccgtatccagcagtgcgcactacaggcctatcaggcgctggactgc
gccggcatggcgcgcgtggatgtgttcctgtgcgcggatgggcgcatcgtcatcaacgag
gtcaacaccttgcccggcttcacccgcatcagcatgtatcccaagttgtgggaggcaagc
gggctggactatcgcagcctggttacgcgcttgatcgagctggcactggagcggcatgcc
gacgatgggcgcctgtacagcagcgtggtcacgcacgcgtga

DBGET integrated database retrieval system