KEGG   Xanthomonas campestris pv. campestris 8004: XC_0389
Entry
XC_0389           CDS       T00247                                 

Definition
(GenBank) glucose inhibited division protein A
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcb03016]
    XC_0389
   03036 Chromosome and associated proteins [BR:xcb03036]
    XC_0389
Transfer RNA biogenesis [BR:xcb03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    XC_0389
 Prokaryotic type
    XC_0389
Chromosome and associated proteins [BR:xcb03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    XC_0389
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 AlaDh_PNT_C Pyr_redox_3 Pyr_redox DAO
Other DBs
NCBI-ProteinID: AAY47474
UniProt: Q4UZP9
LinkDB
Position
complement(450928..452832)
AA seq 634 aa
MSDSFYRYDVIVIGGGHAGTEAALAAARAGARTLLLTHNIETVGAMSCNPAIGGIGKGHL
VKEIDALGGAMAKAADLAGIQWRTLNASKGPAVRATRCQADRNLYRSAIRRIVEAQPNLT
VFQAAVDDLIIHNGAAEGDSVRGVITQTGLRFEATAVVLTAGTFLAGKIHVGETQYAAGR
MGDPPATTLAARLRERPFAIDRLKTGTPPRIDGRTLDYTMMDEQPGDDPLPVMSFMGQVS
DHPTQVSCWITHTTEQTHDIIRGALHRSPLYSGQIEGIGPRYCPSIEDKVVRFADKTSHQ
IFVEPEGLDVTEIYPNGISTSLPFDVQLALVRSIRGFAQAHITRPGYAIEYDFFDPRGLK
ASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARQAQALPAWSPRRDEAYLGVLV
DDLITHGTTEPYRMFTSRAEYRLQLREDNADLRLTGVGRAMGLVDDARWARFSSKQEAVQ
RETARLSALWATPGNALGREVVDTLGVPMSRETNVLDLIKRPELSYAALMRVPTLGPGVD
DAQVAEQVEIGVKYAGYLNRQRDEIARQQRHETTPIPEGFDYAGVRGLSMEVQQKLERVR
PQSIGQAQRIPGMTPAAISLLLVHLERARRSQVA
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgtccgactccttctatcgctacgacgtcatcgtgattggtggcggccacgccggcacc
gaggcggcgctggcggctgcccgcgccggtgcacgcacgctgttgctgacccacaacatc
gagaccgtgggcgcgatgagctgcaacccggccatcggtgggatcggcaaggggcacctg
gtcaaggagatcgacgcactgggcggggcgatggccaaggcggcggacctggccggcatc
cagtggcgcaccctcaatgcctccaaggggccggcggtgcgggccacccgctgccaggca
gaccgcaacctgtaccgcagcgccatccgccgcatcgtcgaagcgcagcccaacctgacc
gtgttccaggcggcagtggacgatctgatcatccacaacggtgccgccgaaggcgacagc
gtgcgtggggtgatcacccagaccgggctgcgcttcgaggccacggccgtggtcctgacc
gcaggcaccttcctggccggcaagatccatgtcggcgagacccaatacgcggccgggcgc
atgggcgacccgccggccaccacgctggcagcgcgtctgcgcgagcgcccgttcgccatc
gatcgcctcaagaccggaactccgccgcgtattgatgggcgtaccctcgactacacgatg
atggatgagcagccaggtgatgacccgctgccggtgatgtcgttcatgggccaggtcagc
gaccacccgacccaggtcagctgctggatcacccataccaccgagcagacccacgacatc
atccgtggcgcgttgcaccgctcgccgctgtattcggggcagatcgagggcattggcccg
cgctactgcccgtcgatcgaagacaaggtggtgcgtttcgccgacaagaccagccatcag
atctttgtcgaaccggaaggcctggacgtcaccgagatctatcccaacggtatttccacc
tcgctgccgttcgacgtgcaactggcgctggtgcgctcgatccgcggttttgcgcaggcg
catatcacccgcccgggctacgcgatcgagtacgacttcttcgacccgcgcgggctcaaa
gcctcgctggaaaccaaggcggtgggcgggctgttcttcgccgggcagatcaacggcacc
accggttacgaagaagccgccgcgcagggcctgttggccgggctcaacgctgcacgccag
gcgcaggcgctgccggcctggtcgccgcgccgcgacgaagcctacctgggcgtactggtg
gacgacctgatcacccacggcaccaccgagccgtaccgcatgttcaccagccgcgccgaa
taccggctgcagctgcgcgaagacaacgccgatctgcggctgaccggcgtgggccgcgcc
atgggcctggtcgacgatgcgcgctgggcacgcttttccagcaagcaggaggcggtgcag
cgcgaaactgcgcgcctgtcggcactctgggccacgccgggcaatgccctgggccgcgag
gtggtcgacaccctgggcgtgccgatgagccgcgagaccaatgtgctggacctgatcaag
cgcccggaactcagctacgccgcgctgatgcgggtgccgacgctgggcccgggcgtggac
gatgcgcaggtcgccgaacaagtggaaatcggcgtcaaatacgccggttacctgaatcgt
cagcgcgacgaaatcgcccgccagcagcgccacgaaacgactccgatcccggaaggcttc
gactacgccggcgtgcgtggcctgtcgatggaagtgcagcagaaacttgaacgcgtgcgc
ccgcaaagtatcggccaggcacagcgcattccgggcatgaccccggccgcgatctcgctg
ctgctggtgcacctggaacgcgcgcggcgcagccaggtggcgtga

DBGET integrated database retrieval system