KEGG   Xanthomonas campestris pv. campestris 8004: XC_0616
Entry
XC_0616           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA HI0933_like DAO FAD_binding_2 NAD_binding_8 NAD_binding_9 Lycopene_cycl FAD_oxidored Thi4 Zn_Tnp_IS1595 K_oxygenase
Other DBs
NCBI-ProteinID: AAY47696
UniProt: A0A0H2X3S8
LinkDB
Position
734140..735039
AA seq 299 aa
MHYDVIIIGGSYAGLSAGLQLARARRRILVLDSGLRRNRFAATSHGFFSRDGESPAQIAA
HGRTQLRAYPDVHWADAEVTQVDGTAEAFRVTLGNGGAHMARRLIIATGVVDRLPDIPGL
AERWGKQIFVCPYCHGYELEQGRIGVLATSAFAVHQAAMLPDWGVTRLFLNDALVLDAKQ
NAQLQARGVTLVPGAVARIQGDDAHVEVVLRDGQTTQLDGLFITTQTHISPVVTAMGCAL
ADGPLGSHVAVDAMQATSVPGVFACGDIASPAASVTFAVASGAMAGVAAHRSLIFGLPA
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcactacgacgtgatcatcatcggtggcagctacgcgggactttcggccggcttgcag
ctcgcgcgtgcacgccgccgcattctggtgctggatagcggtctgcgccgcaatcgcttc
gccgcaacctcgcatggcttttttagccgcgacggcgagtcgcctgcgcagattgccgcg
cacgggcgcacgcagttgcgcgcgtatcccgatgtgcactgggccgatgccgaggtgacg
caggtggacggcaccgcagaggcattccgcgtgacgcttggcaatggtggggcccacatg
gcgcgccgtctcatcattgccacgggtgtggtggaccgcctgccggatatcccgggcctg
gccgagcgctggggcaagcagatcttcgtttgcccgtattgccatggctacgaactggag
cagggacgtattggtgtgctggccacttctgcgtttgcggtgcatcaggccgcgatgctg
ccggattggggcgtcacccgcctgttcttgaacgatgcgctggtcttggacgccaagcag
aacgcccaactacaggcacgcggcgtgaccctggtgccaggcgcggtggcccgcatccag
ggcgacgacgcgcatgtggaggtggtgctgcgcgatgggcaaaccacacaattggacggc
ctgttcatcaccacgcaaacccacatcagccctgtggtgacggcaatggggtgcgccctg
gcggacgggccactgggcagccatgtagcggtggatgcaatgcaggcgacctcggttccc
ggggtctttgcatgcggcgacattgccagccccgcagcctcggtgaccttcgcggtggcc
agcggtgccatggccggcgtggccgcgcatcgctcgctgatctttggcttgccggcgtga

DBGET integrated database retrieval system