KEGG   Xanthomonas campestris pv. campestris 8004: XC_1539
Entry
XC_1539           CDS       T00247                                 

Definition
(GenBank) reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00480  Glutathione metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XC_1539
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     XC_1539
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored DAO FAD_binding_2 GIDA HI0933_like K_oxygenase Thi4 NAD_binding_8 AlaDh_PNT_C 3HCDH_N
Other DBs
NCBI-ProteinID: AAY48605
UniProt: A0A0H2X618
LinkDB
Position
1847313..1848683
AA seq 456 aa
MSARYDYDVVVLGGGSGGLAAAFRAAKHGARVAIMEPGELGGTCVNLGCVPKKAMWLAAD
LASKIELAGALGFDVVRPTLTWQELVTHRQGYIGNIHASYRRRLDDDGVVLIPQRGVLQD
RHTLMGADGVPVTAEHIVIATGAHPLRPHVEGAEHGHVSDDFFNLCHAPDHVAIVGGGYI
AVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFRTTGVQRDD
TGKLRMRGHSAHPGELGNDVFDQVFFAIGRLANTAGLGLEALGVELGKKGEIVVDDGQTT
NVPNIHAVGDVDGKVGLTPVAIAAGRKLMDRLFGGQPDARMDYDNVPSVVFSHPPLGAVG
LTEEQARERYDGAVRVYRSNFRPMLHALADAPQRSVFKLVCVGEEERVVGVHLLGESADE
MLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagcgcacgttacgactacgacgtggtggtgctgggcggtggctccggtggtcttgcc
gcagcgttccgcgcagccaagcatggcgcgcgtgttgcgatcatggagccgggcgagctc
ggcggaacctgcgtcaatctcggctgcgtgccgaagaaggcgatgtggttggcggccgat
ctggcgagcaagatcgaactggctggtgcactcgggtttgatgtggtgcgcccgaccttg
acctggcaggaattggtcacccaccggcagggctacatcggcaatatccacgccagttac
cggcgccgcctcgacgatgatggtgtggtgctgatcccgcagcgtggcgtgttgcaggac
cggcataccttgatgggcgccgacggcgtgcccgtcactgccgagcacatcgtcatcgcc
acgggcgcgcatccattgcgcccgcacgtggagggcgccgagcatggtcatgtgtccgac
gacttcttcaacctctgccatgcgccggaccatgtggccatcgttggaggcggctacatc
gcggtggagattgcggggctgttgcaggcgcttggcagccgcgtgcatctgttcgtgcag
ggcgagcggttgctggaacgcttcgacgccgaactcacgttgcagctggccgataacctg
cgccatctcggcgtgcgcctgcacttcggtttccgcaccaccggtgtgcagcgcgatgac
acgggcaagctacgcatgcgtggccacagtgcgcatccgggcgagttgggcaacgatgtc
tttgaccaggttttctttgcgattggccgccttgccaacaccgccgggctgggcctggaa
gcgctcggcgtggaactcggcaagaagggcgaaatcgtcgtggacgacggccagaccacc
aacgtgcccaacattcatgcggtaggcgatgtggacggcaaggttgggctgacgccggtg
gcgatcgcggcggggcgcaagttgatggatcgcctgttcggtggtcagccggatgcgcgc
atggattacgacaacgtgcccagcgtggtgttttcgcacccgccgctgggtgcggtgggc
ctcaccgaagagcaggcgcgtgagcgctacgacggtgcggtgcgcgtgtaccgcagcaac
ttccgcccgatgttgcacgcattggccgatgcgccgcagcgcagcgtgttcaagctggtg
tgcgtgggcgaggaagagcgcgtggtcggcgtgcacctgctcggcgaaagcgccgacgag
atgctgcagggctttgcggtggcggtcaaaatgggcgccaccaagcgcgacttcgacgag
accgtggcgatccatcccacctcatccgaagaaattgtgttgatgcattga

DBGET integrated database retrieval system