KEGG   Xanthomonas campestris pv. campestris 8004: XC_1615
Entry
XC_1615           CDS       T00247                                 

Definition
(GenBank) iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XC_1615
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N GH101_N
Other DBs
NCBI-ProteinID: AAY48681
UniProt: A0A0H2X7W1
LinkDB
Position
complement(1937881..1938459)
AA seq 192 aa
MPIEHLALPYSRAALEPHLSAATVDAHHGVCHRSEVERLNARIEGSEFAELMLEEIIAQA
QGTLFQLAAQVWNHNFYWQCLRPRGGGEPLGRLADSIAASFGDFVHFKQEFNRIAFGTVG
SGWVWLVQRPDGRLAVVATPNASTPLTGPDTALLACDLWEHAYYLDHQQDRAQYLDAFWK
LINWDFVASRLR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgccgatcgaacaccttgctctgccctactcccgcgccgccctggagccacatctgtcg
gctgcgacagtggacgcccaccatggcgtgtgccatcgcagcgaggtcgaacggctcaat
gcgcgcatcgaaggcagcgagtttgccgagctgatgctggaagagatcatcgcgcaggcg
cagggcacgttgttccagcttgccgcgcaagtgtggaaccataatttctattggcagtgc
ctgcgcccgcgcggcggcggcgaacccctgggccggctggccgacagcatcgcggcatcg
ttcggcgacttcgtgcacttcaagcaggaattcaaccgcatcgcgttcggcacggtgggt
tcgggttgggtgtggctggtgcagcgcccggatggcagattggccgtggtggctactccg
aatgcctccacgccgctgaccggcccggacaccgcgctgctcgcctgcgatctgtgggaa
cacgcctactacctggatcatcagcaggaccgcgcgcagtacctggatgcgttctggaaa
ctgatcaattgggactttgtggccagccgtctgcgctga

DBGET integrated database retrieval system