KEGG   Xanthomonas campestris pv. campestris 8004: XC_1700
Entry
XC_1700           CDS       T00247                                 

Definition
(GenBank) oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00330  Arginine and proline metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    XC_1700
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     XC_1700
SSDB
Motif
Pfam: Pyr_redox_2 NAD_binding_8 FAD_binding_3 FAD_oxidored FAD_binding_2 HI0933_like DAO Thi4 GIDA AlaDh_PNT_C Pyr_redox NAD_binding_7 Lycopene_cycl NAD_binding_9 Amino_oxidase Pyr_redox_3 2-Hacid_dh_C XdhC_C 3HCDH_N Staph_opine_DH SO_alpha_A3
Other DBs
NCBI-ProteinID: AAY48766
UniProt: A0A0H2X654
LinkDB
Position
2039674..2041008
AA seq 444 aa
MACRCVPMAERVRHFDVLVIGAGPAGLAAARAAASHGVQVGVVDAQPRAGGQVWRSDVQH
GAPADARTLLAQVAGDAAITLLTGLQIVLAQPGWLLADGAQGSVQLHYAALVLATGAREL
MLPFPGWTLPGVTGAGAAQALTKQGWPVRGKRVLVAGSGPLLLASAATLQRHGAQVLGIH
EQASAAVLRGFALQLWRWPGKAAQAVALRLQLHAVAYRSGSVVVAAHGDTQLREVEIDGP
AGRSRMACDQLAVGYGLVPNVELAQLLGCQLEPCGAHQQVQVDALLRTSVAQVFAAGEAC
GIGGRECALIEGAMAGHMAADVPDAAQHLQPQRLKARAFAALLQQHFALDPRIRRLAQPD
TLVCRCEDVPLGALDPFNDARDAKLASRCGMGACQGRICGSALAELGRCLPALSTDAGRR
PPLFPVRLAALADSFTSDSQGNHP
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggcatgcaggtgcgtaccgatggctgagcgtgtgcgccatttcgatgtgttggtgatc
ggcgccggcccggccgggctggcggcggcacgggcggccgccagccacggcgtgcaggtg
ggcgtggtggatgcgcagccgcgcgccggcgggcaggtgtggcgcagcgacgtgcagcac
ggtgcgccggccgatgcacgcacgctgctggcgcaggtggccggcgatgcggcgatcacg
ctgctcaccgggctgcagatcgtgctggcgcaaccgggctggctgttggccgacggcgcg
cagggcagcgtgcaattgcattacgccgcgctggtgctggccaccggcgcgcgggaactg
atgctgccgttccccggctggacattgcccggcgtgaccggcgccggtgcggcgcaagcg
ctgaccaagcaaggctggccggtgcgcggcaagcgtgtgctggtggccggcagcgggccg
ttgctgctggccagcgcggccaccttgcagcggcacggcgcgcaggtgctgggcattcac
gaacaagccagcgcggcggtactacgcggcttcgcgctgcagttgtggcgctggccgggc
aaggccgcgcaggcggtggcactgcgtctgcagttgcatgcggtggcttaccgcagcggc
agcgtggtggttgcggcgcatggcgacacccaactgcgcgaagtcgagatcgacggccct
gccgggcgcagccgcatggcctgcgatcagctcgcagtggggtacgggctggtgccgaat
gtcgaactggcgcagttgctgggctgccagctggagccgtgcggtgcgcaccagcaggta
caggtggatgcgctactgcgcaccagcgtggcgcaggtgtttgccgctggcgaagcctgc
gggatcggcgggcgtgagtgcgcgttgatcgaaggtgcgatggccgggcacatggccgcc
gacgtgccggacgcagcgcaacacctgcaaccgcaacggctcaaggcgcgtgccttcgcc
gccctgttgcagcagcacttcgcgcttgatccgcgcattcgccgcctggcccaaccggac
acgctggtgtgccgctgcgaagacgtgccgctgggcgcgctggaccccttcaacgatgca
cgcgatgcgaagttggcctcgcgctgcggcatgggcgcctgccagggccgcatctgcggc
agcgcgctggccgaactgggccgctgcctgcccgcactttccaccgacgccggccgccgg
ccgccgttgttcccggtccgcctcgcggcgctggccgactccttcacttccgactcgcaa
gggaatcatccatga

DBGET integrated database retrieval system