KEGG   Xanthomonas campestris pv. campestris 8004: XC_1789Help
Entry
XC_1789           CDS       T00247                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XC_1789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_1789
Enzymes [BR:xcb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XC_1789
Transporters [BR:xcb02000]
 Other Transporters
  Pores ion channels [TC:1]
   XC_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AAY48852
UniProt: A0A0H2X6N3
LinkDB All DBs
Position
complement(2176040..2176654)
Genome map
AA seq 204 aa AA seqDB search
MHSDRHITLFHNPQSRSRGVLVLLEELGADYSLQRLDLERGDQRDAAFLAINPMGKIPAI
THGNSVVTEQAAIYQYLAELYPDAGLSPAPGDPDRGAYLRWLAFYGSAFEPALIDKAMKR
DAPPRSLSPWADFPTVLAVVDAQLAKGDYLLGARCSAADVLWGSALGWMAGFKMIDPPAP
TLAYIARMAARPAVARAAAVDAGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcgaccgccacatcaccttgttccacaatccgcaatcgcgctcgcgcggagtc
ctggtgctgctggaggaactgggcgccgactacagcctgcagcggctggatctggagcgc
ggcgaccagcgcgatgccgcgttcctggcgatcaacccgatgggcaagattcccgcgatc
acgcacggcaacagcgtggtgaccgaacaggcggcgatctaccaatacctggccgagctg
tacccggacgccgggctgtcgcctgcgccgggcgacccggaccgcggcgcctatttgcgc
tggctggcgttctacggctcggctttcgagccggccctgatcgacaaggccatgaagcgc
gatgcaccgccacgctcgctatcgccatgggcagacttccccaccgtgctggcggtggtg
gatgcccagctggccaagggcgactatctgctcggcgcgcgttgttccgccgccgacgtg
ctgtggggcagcgcgctgggctggatggccggcttcaagatgatcgacccacctgccccg
accctggcctacatcgcacgcatggccgcgcggccagcggtggcgcgggccgcggcggtc
gatgccggcgcctga

DBGET integrated database retrieval system