KEGG   Xanthomonas campestris pv. campestris 8004: XC_2751
Entry
XC_2751           CDS       T00247                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00020  Citrate cycle (TCA cycle)
xcb00260  Glycine, serine and threonine metabolism
xcb00280  Valine, leucine and isoleucine degradation
xcb00310  Lysine degradation
xcb00380  Tryptophan metabolism
xcb00620  Pyruvate metabolism
xcb00630  Glyoxylate and dicarboxylate metabolism
xcb00640  Propanoate metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01200  Carbon metabolism
Module
xcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_2751
   00020 Citrate cycle (TCA cycle)
    XC_2751
   00620 Pyruvate metabolism
    XC_2751
   00630 Glyoxylate and dicarboxylate metabolism
    XC_2751
   00640 Propanoate metabolism
    XC_2751
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XC_2751
   00280 Valine, leucine and isoleucine degradation
    XC_2751
   00310 Lysine degradation
    XC_2751
   00380 Tryptophan metabolism
    XC_2751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcb04147]
    XC_2751
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     XC_2751
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XC_2751
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox AlaDh_PNT_C GIDA HI0933_like FAD_binding_3 FAD_binding_2 DAO 3HCDH_N FAD_oxidored NAD_binding_8 2-Hacid_dh_C Thi4 Lycopene_cycl UDPG_MGDP_dh_N Pyr_redox_3 Nairovirus_M
Other DBs
NCBI-ProteinID: AAY49800
UniProt: A0A0H2X8R2
LinkDB
Position
3305013..3306449
AA seq 478 aa
MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCLRVGCIPSKAL
LDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYG
FGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPFAKFDGDTIVDNVGGLDFTAV
PKRMAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
LGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKLT
ERGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWV
IYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAMGEPAGFVKVIADAETDRVLG
MHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagcgaacaattcgacgtcgtcgtcatcggtgccggcccggccggttatcacgctgcg
attcgtgcagcgcagctcggcatgaaggtcgcctgcatcgacgcagccatcggcaaggac
ggcaagcccgccctgggcggcacctgcctgcgcgtgggctgcatcccgtccaaggcgctg
ctggattcctcgcgccagttctggaacatgggccacctgttcggcgaccacggcatcagc
ttcaacgacgccaagatggacgtgcccaccatgatcggccgcaaggacaagatcgtgaag
cagttcaccggcggcatcgcgatgctgttcaaggccaacaagatcaccccgtactacggc
ttcggccagttgcagccgggcaacatcgtcaaggtgactcagcacgaaggtggcgagatc
gagctgaagggcaccaacgtgatcctggcggccggttcggaatcgatcgaactgccgttc
gccaagttcgacggcgacaccatcgtcgataacgtcggcggcctggacttcaccgcggta
cccaagcgcatggcagtgatcggtgccggcgtcatcggcctggagctgggcagcgtgtgg
aagcgtctgggcgccgaggtcaccatcctcgaagcgctgccggatttcctggccctggcc
gatgccgaagtggccaagaccgcgctgaaggaattcaagaagcagggtctggacatcaag
ctgggcgccaaggtcagcaagaccgagatcaccggcagcggcgacgccaagcaggtggtg
ctcagctacaccgacgccgccggcgagcagaccctgaccgtggacaagttgctggtcgcc
gtgggccggaaggccgcgaccaagaatctgctggccgatggcaccggcgtcaagctgacc
gagcgtggccagatcgaggtcgatggccattgccacaccggcgtcgacggcgtgtgggcg
atcggcgactgcgtgcgcggcccgatgctggcgcacaagggcttcgaggaaggcattgcg
gtggccgagctgatcgctggcctgcccgggcacgtcaactttgacaccattccgtgggtc
atctacaccgagccggaaattgcctgggtcggcaagaccgagcagcagctcaaggccgaa
ggcgttgcctacaaggccggcagcttcccgtttgcggcgatcggccgtgcggtggccatg
ggcgagccggccggcttcgtcaaggtgattgccgatgccgaaaccgaccgcgtgctgggg
atgcacctggtgggcgtgggtgtctcggagctggtgcacgaaggtgtgctgacgatggag
ttcagcggctcggcggacgatctggcgcgcatctgccatgcgcacccgaccctctccgaa
gcaatccacgacgccgccatggcggtgagcaagcgcgccattcacaaggcgaattaa

DBGET integrated database retrieval system