KEGG   Xanthomonas campestris pv. campestris 8004: XC_3165
Entry
XC_3165           CDS       T00247                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XC_3165
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     XC_3165
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 cNMP_binding K_oxygenase FAD_binding_3 Pyr_redox DAO NAD_binding_8 HI0933_like Thi4 FAD_binding_2 FAD_oxidored Lycopene_cycl NAD_binding_9 GIDA MliC UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AAY50209
UniProt: A0A0H2XBQ5
LinkDB
Position
complement(3791729..3793396)
AA seq 555 aa
MDTAQLAITRRFASGPPRRFDAGEMVFDVGDAHAPVWVVLEGAIEVVRRDGLGNEKPITL
HTPGQFTGEVSQLAGRASLAAGRAGEHGCLALPFDTAHLRALMISSAEVGEVVMRALILR
RVGLIEGDASGSVLIGEPDDPHLTRLQGFLTRNGYPNTVMDVSDEDGRALVERLGIQEQD
LPVMVCPSGRVLRQPSDAEAAHCLGMTPDIDPDHRYDVAIVGAGPAGLATAVYAASEGLS
VIVLDQRAIGGQAGASARIENYLGFPTGISGQALAGRAYNQALKFGAELAIPLEAATLEC
GREDGALRLDLADGKQLQASTVVIASGARYRRPQIDQLDRFEGHGVSYWASPVEARLCEG
GVVALVGGGNSAGQAVAFLAPRVKELHLIIRGEGLEASMSQYLIERIAALPNVTLHTGTE
VAALEGDPERGLQAAVLRTRADGQTQRLELRHLFLFVGADPNTGWLQQCVETDAHGFVVT
GSVRAEGLPPCLPLETNRRGVFAIGDVRAGSVKRVAAAVGEGAAVVAQIHQFLAHQATPV
AVSELANATQESATS
NT seq 1668 nt   +upstreamnt  +downstreamnt
ctggatacggcgcaactcgccatcacccggcgctttgccagcggcccgccgcggcgcttc
gacgccggcgagatggtgttcgacgtgggcgatgcgcacgcgccggtctgggtggtgctg
gaaggcgccatcgaggtggtgcgccgcgatggcctgggcaacgaaaaacccatcaccttg
cacacgcccgggcaattcactggcgaagtgagccagcttgccgggcgcgcgtcacttgcc
gccgggcgcgcgggcgagcacggttgcctggcgttgccgttcgacaccgcgcatctgcgc
gcgctgatgatcagctcggccgaagtgggcgaggtggtgatgcgcgcgctgatcctgcgc
cgcgtggggctgatcgagggcgatgcctccggctcggtgctgatcggcgaacccgacgac
ccgcacctgacccggctgcagggctttctcacccgcaacggctatcccaacacggtgatg
gatgtgtccgacgaggacggccgcgcgctggtggagcggctgggcatccaggaacaggac
ctgccggtgatggtgtgccccagcgggcgcgtgctgcgccagcccagcgatgccgaagcc
gcgcattgcctgggcatgacgcccgacatcgacccggatcaccgctacgacgtggcgatt
gtgggcgccggcccggcgggcctggccaccgcggtgtacgcggcctccgaaggcctgtcg
gtgattgtgctggaccagcgcgccattggcgggcaggccggcgcgtcggcacggatcgaa
aattacctgggctttcccaccggcatctctggccaggcgctggctgggcgcgcctacaac
caggcgctgaaattcggtgctgagctggccattccgctggaagcggccacgctggaatgc
gggcgcgaagacggggcattgcggctggatctggccgatggcaagcagctgcaggccagc
acggtggtgatcgcctcgggcgcacgctatcggcggccgcagatcgaccagctggaccgt
ttcgaaggccacggcgtctcgtactgggcctcgccggtggaagcacgcctgtgcgagggc
ggcgtggtggcgttggtgggcggcggcaattccgccgggcaggcagtggcattcctggcg
ccgcgggtgaaggaactgcacctgatcatccgtggcgaaggcctggaagcgtcgatgtcg
caatacctgatcgaacgcatcgccgcgctgcccaacgtgacgttgcacaccggcaccgaa
gtggccgcgctggaaggcgaccccgagcgcggtctgcaggcggcggtgctgcgcacgcgt
gccgatggccagacccaacgcctggagctgcgccacctgttcctgttcgtgggcgccgac
cccaacaccgggtggctgcagcagtgcgtggaaaccgatgcgcatggcttcgtggtgacc
ggcagcgtgcgcgccgaagggctgccaccgtgcctgccgttggagaccaaccgccgtggc
gtgttcgccattggcgatgtgcgcgccggctcggtcaagcgcgtggctgccgccgtgggc
gagggtgccgcggtggtcgcgcagatccatcaattcctggcgcaccaggccacgccggtg
gccgtttccgaacttgccaacgccacgcaggagtccgcgacctcatga

DBGET integrated database retrieval system