KEGG   Xanthomonas campestris pv. campestris 8004: XC_3515Help
Entry
XC_3515           CDS       T00247                                 

Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00550  Peptidoglycan biosynthesis
xcb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XC_3515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XC_3515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
    XC_3515
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xcb03036]
    XC_3515
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XC_3515
Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   XC_3515
Chromosome and associated proteins [BR:xcb03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    XC_3515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AAY50558
UniProt: A0A0H2XCI5
LinkDB All DBs
Position
complement(4176542..4178413)
Genome map
AA seq 623 aa AA seqDB search
MCAMKAGRNRPRSNFNLRGRLTLVGVALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLR
ELPIATSRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELATALGQPLDELNAKL
AQKAGKEFMYLKRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRG
QEGLELAFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKE
LRNALVENKAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGS
TMKPLTVATALTAGVVTKDTIIDTNPGYMAVGRFTIRDVPRNNGVLNVTGVITRSSNIGA
AKIAAKVPDQTFYQSIRNFGYGSAPQSGFPGESSGMVLQPQKWSGPSKTTMSYGYGLSVT
PLQIAQAYATLGNGGKLTPPTFVRGQHNETRQVVTPEVARQVIDMMETVVTQGGAKGAAI
LGYHVAGKTGTARKNGAGGYERGHYNALFAGLVPATRPRFATVIVINDPQGKVYYGGLVS
APVFHRVMEGALRLMDVPPDDIQSWLAAQAAGKTGQPVVKPQPADLDPALVPDPVDEVSA
GIPTALASGATPAQPAPLQESRQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccatgaaagccggccgcaaccgcccccgtagcaacttcaacctgcgcggccgc
ctgaccctggtcggcgtggcgctgggtctgtgctcggtgacgctgatcggccgcgcggcc
tacgtgcagctggtcaatcgcgatttctaccagcgccagggcgaggcccgctatctgcgc
gagctgccgatcgccacctcgcgcggcatgatcaccgaccgcaacggcgagccgctggcg
gtgtccacgccggtggaatcgatctgggtcaatccgcaggaattgctgcgtaacccggac
cgcatcccggagctggccaccgcgctcgggcagccgctggacgagttgaacgccaagctg
gcgcagaaggccggcaaggaattcatgtacctcaagcgccggatcaacccggacaaggcg
catgcgatcgtggatctgaagatcccgggcgtgttttcgcagcgcgagttccgccgcttc
tatccgcaaggcgaagcgatggcccacgtgctgggcttcaccaatatcgacgaccgcggc
caggaaggcctggagctggccttcgacgaatggctgcgcggcaagccgggctccaagaag
gtggtgcgcgatgcccgcggcgccattgtcgagagcgtggacctggtgcgtccggcgcag
ccgggcaaagacctgacgctgagcatcgaccgccgcatccagttcctggcctacaaggag
ctgcgcaacgcgctggtcgaaaacaaggccgctggcggctcgatggtggtgatggacgtg
gccaccggcgaagtgctggccatggtcaacctgcccacctacaacccgaattcggtcacc
ggcatcaacccgtcggcgcgccgcaaccgcgcggtcaccgacctggtggagccgggctcg
acgatgaagccgctgaccgtggccaccgcgctgactgccggcgtggtgaccaaggacacc
atcatcgataccaaccccggctacatggccgtggggcgcttcaccatccgcgacgtgccg
cgcaacaacggcgtgctcaacgtcaccggcgtgatcacccgcagttccaacatcggcgcg
gcgaagatcgcggccaaggtgccggaccagacgttctaccagtcgatccgcaacttcggt
tacggcagcgcgccgcagagcggatttccgggcgaatcgtccggcatggtgctgcagccg
cagaagtggagtggcccgtccaagaccaccatgtcctacggttacggcctgtcggtgacg
ccgctgcagattgcgcaggcgtacgcgacgttgggcaatggcggcaagctgaccccgccc
accttcgtgcgcggccagcacaacgaaacacgccaggtggtgacgccggaagtggcgcgc
caggtcatcgacatgatggaaaccgtggtcacccagggcggcgcgaagggtgcggcgatc
ctggggtatcacgtggccggcaagaccggtaccgcgcgcaagaacggcgctggcggctac
gagcgcgggcactacaacgcgctgttcgccggcctggtgccggccacccggccgcgcttt
gccacggtcatcgtgatcaacgatccgcagggcaaggtgtattacggcggcctggtgtct
gcgccggtgttccaccgggtgatggaaggcgcgctgcggctgatggacgtgccgccggac
gacatccagtcgtggctggccgcgcaggcggccggcaagaccggccagccggtggtcaag
ccgcagccggccgatctcgacccggcgttggtgccggacccggtggacgaagtgtccgcc
ggcatcccgaccgcactggcatcgggcgccacgcccgcgcagccggcgccgttgcaggag
agccgccagtga

DBGET integrated database retrieval system