KEGG   Xanthomonas campestris pv. campestris 8004: XC_4208Help
Entry
XC_4208           CDS       T00247                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00052  Galactose metabolism
xcb00511  Other glycan degradation
xcb00600  Sphingolipid metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    XC_4208
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    XC_4208
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XC_4208
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XC_4208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AAY51246
UniProt: A0A0H2XCP8
LinkDB All DBs
Position
complement(4970573..4973464)
Genome map
AA seq 963 aa AA seqDB search
MTPAVMQQQATTAAQRVSERGVGVAMTGAMRLRVVLYRLCRRARDGRPGTTQQPLQRSLR
AGCMALICLCTTAGVVTAAEPTNAPRERISLNADWRFRRGDPPGNTVRLEYDVRPEVVRS
EDGKVADARPEQAQRIDADARNVLKPWILPTANSLIADPTQRHVRPPGHPGSAVAYVQPM
FDDSAWQRVDLPHDWAIAGPFLADGPHGGMGRLPSWGVGWYRKALQIPASDRGRSLFLDL
DGAMSYATVWLNGKLVGGWPYGYTSWRVDLTPYVVPGGHNQLTIRLDNPPDSARWYPGGG
LYRNVWLTKTGPLRVAQWGTQLSTPQVSAERAQVQLAVQLDNAGAAPVQAQVSTALYALD
DASGLRRGPAVAQIAAVQVQVAAGGNARVQGSTQIEAPRRWGPPPTQQPHRYVAVTEVSQ
GGRVVDRVETPFGVRSVVFDPDKGLVINGEHVPIRGVNNHHDLGALGAAFNVRAAERQLQ
LLQHMGANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLIFPQWHEPD
LRAMLRRDRNHPSIILWSVGNEVGEQYTGEAGAAIARRLHAIVHAEDPTRPATAAMNYAS
PEMPLPAALDVISLNYQGEGIRDTPEFEGTERIRKPPQYPAFHAKFPRKAILSSETASAL
SSRGVYLFPVSAQSSAPVRDGRGGDSVAHQVSAYELHAVDFGSSADKVFAALDRHPFVAG
EFVWTGFDYLGEPTPYYSSRSSYSGILDLAGFPKDRYWLYQARWRPELPMAHLLPHWSWP
GREGQVTPVHVFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELRVQAYKHGR
PWASDRVQTAGRATRMQLSADRNQIRGDGKDLSFITVRLLDADGRPAPTAGDRLRFRVEG
AGELVATDNGDPTNLEAFVLPERNAFNGLCLVIVRAKPGAQGPITVHVQSDTLQSASVQV
LAE
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagccgttatgcagcagcaggcaaccacggccgcacagcgcgtgagcgagcgc
ggcgtaggtgtggcgatgaccggtgccatgcgcctacgcgttgtgctgtatcgcctctgc
aggcgtgcacgcgatgggcgcccaggcactacgcagcagccgctgcagcgcagcctgcgc
gctggatgcatggcgctgatctgcctctgcactaccgcaggtgtggtcacagcggcggag
ccaaccaacgcgccgcgcgaacggatctcgctcaacgccgactggcgcttccgccgtggc
gacccgcctggcaataccgtgcggctggagtacgacgtacgcccggaggtggttcgcagc
gaagacggcaaggtggccgatgcgcggcccgagcaggcgcaacgcatcgacgccgacgcg
cgcaacgtgctcaaaccgtggatcctgccgactgccaatagcctgatcgccgaccccacg
cagcggcatgtgcgcccgcccgggcacccgggcagtgcggtggcctacgtgcagcccatg
ttcgacgacagcgcgtggcagcgcgtggacctgccacacgattgggcaattgcagggccg
ttcctggccgatggcccgcatggcggcatggggcgattgccgagctggggcgttggctgg
tatcgcaaggcgctgcagattccggccagcgaccgcggccgctcgctgtttctcgatctc
gatggcgcgatgtcctacgccaccgtctggctcaacggcaagctggtgggcggctggccg
tatggctacaccagctggcgcgtggatctcacgccgtatgtggtgcccggcgggcacaac
cagctcacgatccggctggacaacccgcccgactcggcgcgttggtatcccggcggtggc
ctgtatcgcaatgtctggttgaccaagaccggcccgctccgcgttgcccagtggggcacg
cagctgagcacgccgcaggtgtcggccgagcgggcgcaggtgcagctggcggtgcagctg
gacaatgccggtgccgcccccgtgcaggcgcaggtgagcaccgcgctgtacgcgctggat
gacgccagcggcctgcgccgtggcccggcggtggcgcagattgccgcggtgcaggtacag
gtggcggcgggtggcaatgcacgcgtgcagggcagtacgcagatcgaggcgccacggcgt
tggggtccgccaccgacacagcaaccgcatcgctatgtcgcggtgaccgaggtcagccag
ggtgggcgtgtggtcgatcgtgtcgaaacgccattcggcgtgcgcagcgtggtcttcgac
ccggacaagggcttagtcatcaacggcgaacacgtgcccatccgcggggtcaacaaccat
cacgatctgggcgcgctgggggccgcgttcaacgtgcgcgccgccgagcggcagctgcag
ttactgcaacacatgggcgccaatgccatccgcatgagccacaacccgcccgcgccggaa
ttgctggagctcaccgaccgcatgggtctgctggtggtggatgaggtgttcgacagctgg
gaaatgaaaaagaccccgctggatttccacctgatctttccgcaatggcacgagccggat
ctgcgcgccatgctgcgccgcgaccgcaaccatccctccatcattttgtggagcgtgggc
aacgaagtgggcgagcaatacaccggcgaagcgggcgccgcgatcgcacgcaggctgcac
gccatcgtgcacgccgaagaccctacgcgcccggcgacggcggcgatgaactacgcctca
cccgagatgccgctgccggcggcgctggatgtaatcagcctcaattaccagggcgaaggc
atccgcgatacgcccgagttcgaaggcaccgagcgtatccgcaagccgccgcagtacccg
gccttccatgccaaattcccgcgcaaggccatcctcagcagcgagacggcctcggcgctg
agcagccgcggcgtgtacctgtttccggtgagtgcgcagagcagcgcgccggtgcgcgat
ggccgcggcggcgattcggtggctcaccaggtcagtgcgtatgagctgcacgcggtggat
ttcggctccagtgccgacaaggtctttgccgcgttggatcggcatccgttcgtggccggc
gagtttgtgtggaccggcttcgactatctcggcgagcccacgccgtactacagctcacgc
agttcctattccggcattctggatctggctggcttccccaaggaccgctactggctgtat
caggcgcgctggcggccggagctgccgatggcgcacctgctgccgcactggagctggccg
gggcgcgagggccaagtgacgccggtgcacgtgttcacctccggcgacgaggccgagctc
ttcgtcaacggcgtctcgcaaggccgcaagcgcaaggcaccgttgcagtaccggctgcgc
tgggatgcggtggtgtaccaaccgggagagctgcgcgtgcaggcttacaaacatggcagg
ccgtgggccagcgaccgtgtgcagaccgccggccgtgccacgcgcatgcagctcagcgcc
gaccgcaaccagatccgtggcgatggcaaggacctgagtttcatcaccgtgcgcctgctt
gatgccgacgggcgccctgcaccgactgcaggtgaccgcttgcgattccgcgtggaaggc
gcaggcgaactggtcgccaccgacaacggtgacccgaccaacctggaggccttcgtcctg
cccgagcgcaacgcgttcaacggtctgtgcctggtgatcgtgcgcgccaaaccgggcgcg
caggggccgatcaccgtgcatgtgcaatccgacacgctgcagtccgccagcgtgcaggtg
ctggcggaatga

DBGET integrated database retrieval system