KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0748Help
Entry
XCC0748           CDS       T00083                                 

Gene name
amy
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00500  Starch and sucrose metabolism
xcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCC0748 (amy)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     XCC0748 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 1001375
NCBI-ProteinID: NP_636139
UniProt: Q7CLU8
LinkDB All DBs
Position
complement(894341..895768)
Genome map
AA seq 475 aa AA seqDB search
MHATSRPCPRTFWQRAHQLLLIALTLLLTTASAQADVILHAFNWPYATVEARAKQIADAG
YRKVLVAPAYRSEGSAWWARYQPQDIRLIDNPLGDTTAFARMVQALANNGVETYADVVFN
HMANEAATRSDLNYPGSAVLAQYAANPGRYDALRLFGTVQSNFLSASDFGPAQCISNYND
AFQVRNYRICGGGSDPGLPDLLGNDWVVQQQRAYLQALKGLGVTGFRVDAAKHMTFDHLN
RVFDAGIRSGVYVFGEVITGGGSGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFGVGA
SMQQLVDPASTGQALPGNRAVTFAVTHDIPNNAGFRYAILDPVDETLAYAYLLGRNGGVP
MVYTDNNESGDNRWVNAYLRDDLRRMIGFHNGVQGSDMQVLSSSACHILFRRGSLGIVGI
NKCGNPVNTTVAMNGSVLFWNADYVDALGSGTVVRISSGSYTFTLPARQARMWRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccacctctcgcccctgtccacgcacgttctggcaacgcgctcaccagttgctg
ttgatcgcgctgaccttgttgctgaccaccgccagcgcacaggccgacgtcatcctgcat
gcgttcaactggccctacgccacggtagaagcgcgcgccaagcagatcgccgatgccggg
tatcgcaaggtactggtcgcaccggcctatcgctccgaaggcagtgcctggtgggcgcgc
taccagccgcaggatatccgcctgatcgacaatccactcggcgacaccaccgcgttcgcg
cgcatggtgcaggcactggcaaacaacggtgtggaaacctatgccgacgtggtgttcaac
cacatggccaacgaagcagcaacgcgctcggacctcaattaccccggcagcgcggtgctg
gcgcagtacgcagccaatcctgggcgctacgatgcactgcgcctgttcggcacggtgcag
tccaactttttgagcgccagtgatttcgggccggcgcaatgcatcagcaactacaacgat
gccttccaggtgcgcaattaccgcatctgcggcggcggcagcgatccgggcctgccggat
ctgctcggcaacgattgggtggtgcagcagcagcgcgcctacctgcaggcgctcaagggc
ctgggcgtcaccggcttccgcgtggacgcggccaagcacatgaccttcgaccatctcaac
cgcgttttcgatgccggcatccgctccggtgtgtacgtgtttggtgaagtgatcaccggc
ggtggcagcggcaatggcgactacgaccagttcctggcgccgtatctgcaatccaccccg
catgccgcctacgatttcccgctgttcaacgcggtacgcaatgccttcggtgtgggtgcg
agcatgcaacagttggtggacccggcgtccaccgggcaggccttgccgggcaatcgcgca
gtcacctttgccgtaacgcatgacatccccaataacgcgggcttccgctacgcgattctc
gacccggtcgatgaaacgctggcctatgcgtacttgctgggccgcaacggcggcgtgccg
atggtctacaccgacaacaacgaaagcggcgacaaccgctgggtcaatgcctatctgcgc
gatgatctgcgccgcatgattggcttccacaacggcgtgcagggcagcgacatgcaggtg
ctgtcatccagtgcctgccacatcctgttccgccgcggcagcctcggcatcgtgggcatc
aacaagtgcggcaacccggtcaacaccaccgtcgccatgaacggcagcgtgttgttctgg
aatgcggattacgtcgatgcactgggttccggcaccgtggtgcgcatctccagtggctcg
tacaccttcaccctgccggcgcggcaggcgcgtatgtggcgacgttga

DBGET integrated database retrieval system