KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0833Help
Entry
XCC0833           CDS       T00083                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XCC0833 (ahpF)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XCC0833 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 Glutaredoxin NAD_binding_7 AlaDh_PNT_C FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8 Thi4 Spermine_synth
Motif
Other DBs
NCBI-GeneID: 1001428
NCBI-ProteinID: NP_636224
UniProt: Q8PCA1
LinkDB All DBs
Position
complement(990433..992022)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQIHASIDDIPKAREMLELLEDLVLLSDKISLDVHRDDNQ
RKPSFALTTPGQDISVRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGALFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LVEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDTQHIDLEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADVAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtcacgcggccg
atccagatccatgcttcgatcgacgacatccccaaggcgcgcgaaatgctcgagctgctc
gaggatctggtgctgctctcggacaagatcagcctggacgtgcaccgcgacgacaaccag
cgcaagccctcgttcgcgctgaccacgccgggccaggacatttcggtgcgctttgccggc
ctgccgatggggcacgaattcacctcgctggtgctggcgctgctgcaggttggcggccac
ccttccaaggccactgccgagctgatcgagcaggtgcagcacctggatggcgactatcag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtgctgaacccgcgcatcaagcacgtggccatcgatggcgcgctgttccag
gacgaggtggaaacccgccagatcatgtcggtgcccaccgtgtacttgaacggtgaactg
ttcgaccagggccgcatgacgctggaacagatcgtcgccaagctcgacaccaatgccgcc
aagcgcgatgccgccaagatcgccgccaaggacgccttcgacgtgttggtggttggcggt
ggcccggccggctcggcagcagcggtgtatgccgcacgcaagggcatccgcaccggcgtg
gctgcagagcgtttcggtggtcaggtgctggacaccatgtcgatcgaaaacttcatctcg
gtgccggaaactgaaggcccgaagatggctgccgcgcttgagcagcacgtgcgccagtac
gacgtggacatcatgaatctgcagcgtgccgagcagttgatcccggccggtgccgatggc
ctggtcgaaatcaagctggccaatggcgcatcgctcaagagcaagacggtgatcctgtcc
accggcgcgcgctggaggcagatgaatgtgcccggcgaagaccagtacaggaacaagggc
gtggcctactgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgacgaagtgctgcagcgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctgggcgatggt
cagaaggtcactgggctggtctacaaggaccgcaccggtggcgacacgcagcacatcgac
ctggagggtgtgttcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtggagttgtccccgcgcggcgagatcatcgtcgacgaccgcggccagaccaatgtgccg
ggcgtgttcgcggccggcgacgcgaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaggctgcattgagcgcgttcgattacctgatccgctccagcgcaccg
gtcagcgccgacgtagcccaggctgcgtaa

DBGET integrated database retrieval system