KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1290Help
Entry
XCC1290           CDS       T00083                                 

Gene name
lig2
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc03030  DNA replication
xcc03410  Base excision repair
xcc03420  Nucleotide excision repair
xcc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    XCC1290 (lig2)
   03410 Base excision repair
    XCC1290 (lig2)
   03420 Nucleotide excision repair
    XCC1290 (lig2)
   03430 Mismatch repair
    XCC1290 (lig2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xcc03032]
    XCC1290 (lig2)
   03400 DNA repair and recombination proteins [BR:xcc03400]
    XCC1290 (lig2)
Enzymes [BR:xcc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XCC1290 (lig2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     XCC1290 (lig2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XCC1290 (lig2)
DNA replication proteins [BR:xcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    XCC1290 (lig2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     XCC1290 (lig2)
DNA repair and recombination proteins [BR:xcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     XCC1290 (lig2)
   NER (nucleotide excision repair)
    Other NER factors
     XCC1290 (lig2)
   MMR (mismatch exicision repair)
    Other MMR factors
     XCC1290 (lig2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 1001693
NCBI-ProteinID: NP_636664
UniProt: Q8PB36
LinkDB All DBs
Position
complement(1507897..1509501)
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRSTGTLDKRAALVAYFRAAPPLDAAWALYLLAGGKVASARMRIAASGE
LREWIAEAAGIADWLVADSYDHVGDLAETLALLLDDPASEAVDVSLAEWIEQRLLPIANQ
DVAVRKHCIVQAWRTLAFDERLVFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHATYVADLLTHEALPGDRQQPYPFFLASPLEADVESLGAIDDWLLEWKWDGIRL
QLLRRAGEAALWSRGEERLDGRFPEIEQAAMGLPDGTVIDGELLAWQPEQLLPMPFTALQ
TRIQRLKPGPKTLAAAPARVVAYDLLELDGEDLRERPLHARRALLERVLATLADPRIIAS
PLVHSTDWQAAAQVRLDARARGVEGLMLKRARSPYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHDGALVPIAKAYSGLDDTEILQLDRWIRANTTERFGPVRA
VTPHHVFELGFEGVNRSTRHKSGIAVRFPRILRWRHDKPFAEADHLSSLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggtttgcggcgctgtaccgcaccctggaccgcagcaccggcacgctcgacaag
cgcgccgccttggtggcgtatttccgcgcagcgccgccgctggatgcggcctgggcgctg
tatctgttggcgggtggcaaggtggccagtgcgcgcatgcgcatcgccgccagcggcgag
ttgcgcgagtggatcgccgaggccgccgggatcgccgactggctggtagccgacagctac
gatcacgtgggcgatctggccgaaacactggcattgctgctggatgatccagccagcgag
gcggtggatgtgtcactggccgagtggattgaacaacgcctgctgccgatcgccaatcaa
gacgtggcggtgcgcaagcactgcatcgtgcaggcgtggcgcacgctggccttcgacgaa
cgcctggtcttcaacaagttgctgaccggcgccctgcgcgtgggtgtgtcgcaacggttg
gtgcagcaggcgctggcagaactgtcgggcgtggatatcgcacgcattgcccagcgcatg
ctcggcagctggcgcccgcatgccacgtatgtggccgacctgctcacgcatgaggcgctg
cccggcgaccgccagcagccctacccgttttttctggcatcgccgctggaggccgatgtc
gagagcctgggcgccatcgacgactggctgctggaatggaagtgggatggcatccggctg
cagctgttgcgtcgtgcgggtgaagcggcgctgtggtcgcgtggcgaagaacgcctggat
ggccgctttccagagatcgagcaggctgccatgggcttgccagacggcaccgtgatcgac
ggcgagctgctggcctggcaaccagagcaactgttgccgatgccgttcaccgcgctgcag
acgcgtatccagcggctcaagcccgggcccaagacgctggcggcggcgccagcgcgcgtg
gtcgcctacgacctgctcgaactggacggcgaagacctgcgcgagcgcccgctgcacgca
cgccgcgcactactggagcgcgtgctcgccaccctcgccgacccacgcatcatcgcctcg
ccgctggtgcactccaccgattggcaggccgccgcgcaagtgcgattggatgcacgtgcg
cgcggcgttgaagggctgatgctcaagcgcgcgcgttcgccctaccaatccggccgccgc
cgtggcgactggtggaagtggaagatcgacccactgaccatcgatgcggtgttgctgtac
gcacaggccggccatggccggcgcagcacgctgtacaccgactacaccttcgggctctgg
cacgacggcgcgctggtgcccatcgccaaggcgtattcgggcctggacgataccgagatc
ctgcaactggatcgctggatccgcgccaacaccaccgagcgcttcgggccggtgcgcgcg
gtcacgccgcaccatgtgttcgaactgggctttgaaggcgtgaatcgcagcacgcggcac
aagtccggcattgcggtgcgcttcccgcgcatcctgcgctggcgccatgacaaacccttc
gccgaggccgaccacctgagcagcctgcaggcactggcgcggtga

DBGET integrated database retrieval system