KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1411Help
Entry
XCC1411           CDS       T00083                                 

Definition
(RefSeq) MarR family transcriptional regulator
  KO
K15974  MarR family transcriptional regulator, negative regulator of the multidrug operon emrRAB
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xcc03000]
    XCC1411
Transcription factors [BR:xcc03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    XCC1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 Rrf2 B-block_TFIIIC
Motif
Other DBs
NCBI-GeneID: 1001828
NCBI-ProteinID: NP_636784
UniProt: Q8PAR7
LinkDB All DBs
Position
1643753..1644253
Genome map
AA seq 166 aa AA seqDB search
MSSFDPTAKRVDHTCERYPPFPREPAVLVRLIKHLYKRLHTQACVRLKPHGISPPEYEIL
MMLYGTPGQAITPTEVAEAASEKPANITRLTDQLHEKGLIARASSPDDRRKITLTLSPAG
LALIDRLLPEACTLLDAETAQISEAEQVRLEKLLKKLLAGVDAVEQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctttgatccaaccgctaaacgcgtcgaccacacttgcgagcgttacccgcct
tttccccgggagccggccgtcctggtgcggctgatcaagcacctctacaagcggctgcac
acccaggcctgcgtgcggctcaagccgcatggcatcagcccgccggagtacgaaatcctg
atgatgttgtatgggacgccggggcaggcaatcacgccaaccgaagtggcagaggcggcc
agtgagaagccggccaacatcacccggctgaccgatcaattgcacgagaaagggctgatt
gcgcgcgccagcagcccggacgaccgccgcaagatcaccttgacgctctcgccggctggg
ctggcattgatcgatcggctgttgccggaggcctgcaccttgctggatgcggagaccgcg
cagatcagcgaggccgagcaggtgcgccttgagaaactgctgaagaaattgctcgccggc
gtggacgcagtcgaacagtaa

DBGET integrated database retrieval system