KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2286Help
Entry
XCC2286           CDS       T00083                                 

Gene name
gstA
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCC2286 (gstA)
Enzymes [BR:xcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XCC2286 (gstA)
Transporters [BR:xcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   XCC2286 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 1002195
NCBI-ProteinID: NP_637641
UniProt: Q8P8F6
LinkDB All DBs
Position
complement(2688519..2689217)
Genome map
AA seq 232 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVVVDGG
LTIAESGAILEYLTERYDTECALSPSARPAESAERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLKLHMDWMEQSLGGSGWFAGERFTAADIQM
SFPVQAAAARGGGLEAYPKLRSFIERIEARPAYQAALKKGGPFELQRAKPAT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttactgtccaccacctcaataattcccgctcgcaacgcgtgctctggttgctggaa
gaactggcgttgccgtaccagatcgtgcgccacgagcgcgacccaaagaccatgctggcg
cctccggcgttgcgcgcgatccatccgctgggcaagtcgccggtggtggtcgatggtggg
ctgaccattgccgagtccggcgcgatcctggaatacctcaccgagcgctacgacaccgaa
tgcgcgctgtcgccgtcggcgcggccagcggagtccgccgagcgcctgcaatttcggtac
tggatgcattacgccgaaggctcggcaatgccgccattgctgatgacgctgatctttggg
cgcatccgctcagccccgatgccctttttcgccaagcccattgcgcgcgcgattgtcgac
aaggcgatgtctggcttcgtcgggccgcaactcaagttgcacatggactggatggagcaa
tcgctgggcggcagcggctggttcgcgggtgagcgctttaccgcggccgacattcagatg
agtttcccggtgcaagcggcggctgcgcgaggcggcgggctggaggcctaccccaagctg
cgcagctttatcgagcgcatcgaggcgcggccggcatatcaggccgcactgaagaagggc
gggccattcgagctgcagcgggccaagcccgccacctga

DBGET integrated database retrieval system