KEGG   Xylanimonas cellulosilytica: Xcel_0673Help
Entry
Xcel_0673         CDS       T01135                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00473  D-Alanine metabolism
xce01100  Metabolic pathways
xce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Xcel_0673
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Xcel_0673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xce01011]
    Xcel_0673
Enzymes [BR:xce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Xcel_0673
Peptidoglycan biosynthesis and degradation proteins [BR:xce01011]
 Precursor biosynthesis
  Racemase
   Xcel_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACZ29712
UniProt: D1BWY0
LinkDB All DBs
Position
725729..727054
Genome map
AA seq 441 aa AA seqDB search
MTGVTPFPIDFPARAVVDLEAVRDNVRALRAHAPSSALMAVVKADAYGHGLVPTAWAALA
GGATWLGVAQAAEAVALRAAGIGPGDARILTWLHSPGVDFDPLVAADVDVSVAAPWALDG
VAAAARATGRVARVHLKVDTGLGRNGITPADLPAAAARAAALVAEGAIHVVGVWTHLAYA
DEPGHPTIAAQRVVLDDAVRTVEAAGIEVELRHAANSAATLTAPALHYDLVRPGISVYGF
SPVPGVATASSFGLRPAMTLQARLATVKNVEAGQGVSYAHRYVTTQATQLGVVPLGYADG
IPRHASGGDDGPGGPVYVGGPAGAGIGPAGDGDGGRVVRVAGRVCMDQVVLDLGPYATEQ
PGDVVTLFGSTDGLAHSASVPSAEDWAAAAGTISYEIVTRIAPRIPRVYVGTEVLGERGT
AVGRGRTTPIGDALAEQVGWS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgtgacgccgttccccatcgacttcccggcccgtgccgtcgtcgacctcgag
gccgtgcgcgacaatgtgcgtgccctgcgcgcgcacgcgccgtcgtcggcgctcatggcc
gtggtcaaggccgatgcctacgggcacgggctcgtgccgacggcgtgggcggcgctcgcc
ggcggggccacctggctgggcgtcgcccaggctgccgaggcggtcgctctgcgcgcggcg
ggcatcgggcccggcgacgcccgcatcctcacctggctgcactccccgggggtggacttc
gacccgctcgtcgccgccgacgtcgacgtgtcggtcgcggcgccgtgggcgctcgacggc
gtcgccgcggccgcccgcgcgaccggccgcgtcgcgcgcgtgcacctcaaggtcgacacg
gggctcggccgcaacggcatcacgcccgccgacctgccggccgccgcggcacgtgccgcc
gcgctcgtcgccgagggtgcgatccacgtcgtgggcgtgtggacgcacctcgcgtacgcc
gacgagcccggccaccccaccatcgccgcgcagcgcgtggtgctcgacgacgccgtccgc
accgtcgaggccgccggcatcgaggtggagctgcggcacgccgccaactcggccgccacc
ctcaccgcacccgcgctgcactacgacctcgtgcggcccggcatctccgtgtacgggttc
tccccggtaccgggcgtggcgacggcgtcgtccttcgggctgcggcccgcgatgacgctg
caggcgcggctcgccaccgtcaagaacgtcgaggccgggcagggcgtctcctacgcccac
cggtacgtgaccacccaggcgacgcagctcggcgtcgtcccgctcgggtacgccgacggg
atcccgcggcatgcgtcgggcggggacgacgggcccggcggaccggtgtacgtcggcgga
cctgcgggcgccgggatcgggcccgctggcgacggcgacggcggccgcgtcgtgcgcgtc
gccggacgggtgtgcatggaccaggtggtgctcgacctcggtccctacgccaccgagcag
cccggcgacgtcgtcaccctcttcggctccaccgacgggctcgcgcactccgcgtccgtg
ccgagcgcggaggactgggcggccgccgccggcacgatctcctacgagatcgtcacgcgg
atcgcgccgcgcatcccgcgcgtctacgtcggcacggaggtgctgggcgagcggggcaca
gcggtcggccgagggcgcacgacgccgatcggcgacgcgctcgcggagcaggtcggatgg
tcgtga

DBGET integrated database retrieval system